Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: USP11Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human USP11 Polyclonal Antibody | anti-USP11 antibody

USP11 Antibody - middle region

Gene Names
USP11; UHX1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
USP11; Polyclonal Antibody; USP11 Antibody - middle region; anti-USP11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCV
Sequence Length
963
Applicable Applications for anti-USP11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human USP11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: USP11Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: USP11Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-USP11 antibody
Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 11
NCBI Official Synonym Full Names
ubiquitin specific peptidase 11
NCBI Official Symbol
USP11
NCBI Official Synonym Symbols
UHX1
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 11
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 11
UniProt Gene Name
USP11
UniProt Synonym Gene Names
UHX1
UniProt Entry Name
UBP11_HUMAN

NCBI Description

Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23 [provided by RefSeq, Jul 2008]

Uniprot Description

USP11: Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks. Belongs to the peptidase C19 family.

Protein type: Ubiquitin-specific protease; EC 3.4.19.12; Ubiquitin conjugating system; Protease

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination

Research Articles on USP11

Similar Products

Product Notes

The USP11 usp11 (Catalog #AAA3220914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP11 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP11 usp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVNSNGTSDR TTSPEEVHAQ PYIAIDWEPE MKKRYYDEVE AEGYVKHDCV. It is sometimes possible for the material contained within the vial of "USP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.