Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-USO1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellUSO1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit USO1 Polyclonal Antibody | anti-USO1 antibody

USO1 antibody - C-terminal region

Gene Names
USO1; TAP; VDP; P115
Reactivity
Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USO1; Polyclonal Antibody; USO1 antibody - C-terminal region; anti-USO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQ
Sequence Length
962
Applicable Applications for anti-USO1 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 79%; Human: 100%; Pig: 77%; Rat: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-USO1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellUSO1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-USO1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellUSO1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-USO1 antibody
This is a rabbit polyclonal antibody against USO1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Transport from the ER to the cis/medial Golgi compartments requires the action of this gene product, GM130 and giantin in a sequential manner.
Product Categories/Family for anti-USO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
general vesicular transport factor p115 isoform 2
NCBI Official Synonym Full Names
USO1 vesicle transport factor
NCBI Official Symbol
USO1
NCBI Official Synonym Symbols
TAP; VDP; P115
NCBI Protein Information
general vesicular transport factor p115
UniProt Protein Name
General vesicular transport factor p115
UniProt Gene Name
USO1
UniProt Synonym Gene Names
VDP; TAP
UniProt Entry Name
USO1_HUMAN

NCBI Description

The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

TAP: General vesicular transport factor required for intercisternal transport in the Golgi stack; it is required for transcytotic fusion and/or subsequent binding of the vesicles to the target membrane. May well act as a vesicular anchor by interacting with the target membrane and holding the vesicular and target membranes in proximity. Belongs to the VDP/USO1/EDE1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Vesicle

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: Golgi membrane; Golgi apparatus; Golgi stack; membrane; endoplasmic reticulum; perinuclear region of cytoplasm; nucleolus; cytosol

Molecular Function: protein transporter activity

Biological Process: intracellular protein transport; ER to Golgi vesicle-mediated transport; Golgi vesicle docking; vesicle fusion with Golgi apparatus; transcytosis; mitotic cell cycle

Research Articles on USO1

Similar Products

Product Notes

The USO1 uso1 (Catalog #AAA3216475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USO1 antibody - C-terminal region reacts with Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USO1 uso1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QNEQLQTAVT QQVSQIQQHK DQYNLLKIQL GKDNQHQGSY SEGAQMNGIQ. It is sometimes possible for the material contained within the vial of "USO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.