Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-USF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit USF1 Polyclonal Antibody | anti-USF1 antibody

USF1 antibody - N-terminal region

Gene Names
USF1; UEF; FCHL; MLTF; FCHL1; MLTFI; HYPLIP1; bHLHb11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USF1; Polyclonal Antibody; USF1 antibody - N-terminal region; anti-USF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVF
Sequence Length
310
Applicable Applications for anti-USF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human USF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-USF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-USF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-USF1 antibody
This is a rabbit polyclonal antibody against USF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: USF1 is a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. USF1 can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Two transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
Upstream stimulatory factor 1
NCBI Official Synonym Full Names
upstream transcription factor 1
NCBI Official Symbol
USF1
NCBI Official Synonym Symbols
UEF; FCHL; MLTF; FCHL1; MLTFI; HYPLIP1; bHLHb11
NCBI Protein Information
upstream stimulatory factor 1
UniProt Protein Name
Upstream stimulatory factor 1
UniProt Gene Name
USF1
UniProt Synonym Gene Names
BHLHB11; USF; bHLHb11
UniProt Entry Name
USF1_HUMAN

NCBI Description

This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013]

Uniprot Description

USF1: Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters. Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as an homodimer or a heterodimer (USF1/USF2). Interacts with varicella-zoster virus IE62 protein.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q22-q23

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; enzyme binding; protein homodimerization activity; sequence-specific DNA binding; protein heterodimerization activity; histone deacetylase binding; double-stranded DNA binding; bHLH transcription factor binding; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; lipid homeostasis; glucose metabolic process; late viral mRNA transcription; glucose homeostasis; regulation of transcription from RNA polymerase II promoter; negative regulation of fibrinolysis; cellular response to insulin stimulus; regulation of transcription from RNA polymerase II promoter by glucose; response to hypoxia; regulation of transcription by carbon catabolites; positive regulation of transcription from RNA polymerase II promoter by glucose; positive regulation of transcription from RNA polymerase II promoter; response to UV

Disease: Hyperlipidemia, Combined, 1

Research Articles on USF1

Similar Products

Product Notes

The USF1 usf1 (Catalog #AAA3202052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USF1 usf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGQQKTAETE EGTVQIQEGA VATGEDPTSV AIASIQSAAT FPDPNVKYVF. It is sometimes possible for the material contained within the vial of "USF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.