Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in human colon.)

Rabbit anti-Human, Mouse UQCRC2 Polyclonal Antibody | anti-UQCRC2 antibody

UQCRC2 (Cytochrome b-c1 Complex Subunit 2, Mitochondrial, Complex III Subunit 2, Core Protein II, Ubiquinol-cytochrome-c Reductase Complex Core Protein 2) (FITC)

Gene Names
UQCRC2; QCR2; UQCR2; MC3DN5
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UQCRC2; Polyclonal Antibody; UQCRC2 (Cytochrome b-c1 Complex Subunit 2; Mitochondrial; Complex III Subunit 2; Core Protein II; Ubiquinol-cytochrome-c Reductase Complex Core Protein 2) (FITC); anti-UQCRC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UQCRC2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-UQCRC2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UQCRC2, aa1-453 (NP_003357.2).
Immunogen Sequence
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in human colon.)

Western Blot (WB) (UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in human colon.)

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in mouse kidney.)

Western Blot (WB) (UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in mouse kidney.)

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in A-431.)

Western Blot (WB) (UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of UQCRC2 expression in transfected 293T cell line by UQCRC2 polyclonal antibody. Lane 1: UQCRC2 transfected lysate (48.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UQCRC2 expression in transfected 293T cell line by UQCRC2 polyclonal antibody. Lane 1: UQCRC2 transfected lysate (48.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-UQCRC2 antibody
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
Product Categories/Family for anti-UQCRC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,443 Da
NCBI Official Full Name
cytochrome b-c1 complex subunit 2, mitochondrial
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase core protein II
NCBI Official Symbol
UQCRC2
NCBI Official Synonym Symbols
QCR2; UQCR2; MC3DN5
NCBI Protein Information
cytochrome b-c1 complex subunit 2, mitochondrial; complex III subunit 2; core protein II; ubiquinol-cytochrome-c reductase complex core protein 2
UniProt Protein Name
Cytochrome b-c1 complex subunit 2, mitochondrial
UniProt Gene Name
UQCRC2
UniProt Entry Name
QCR2_HUMAN

NCBI Description

The protein encoded by this gene is located in the mitochondrion, where it is part of the ubiquinol-cytochrome c reductase complex (also known as complex III). This complex constitutes a part of the mitochondrial respiratory chain. Defects in this gene are a cause of mitochondrial complex III deficiency nuclear type 5. [provided by RefSeq, Jul 2015]

Uniprot Description

UQCRC2: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex. Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.

Protein type: EC 1.10.2.2; Mitochondrial; Oxidoreductase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial respiratory chain complex III

Molecular Function: protein binding; metal ion binding; metalloendopeptidase activity; protein complex binding

Biological Process: cellular metabolic process; aerobic respiration; proteolysis; oxidative phosphorylation

Disease: Mitochondrial Complex Iii Deficiency, Nuclear Type 5

Research Articles on UQCRC2

Similar Products

Product Notes

The UQCRC2 uqcrc2 (Catalog #AAA6398087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UQCRC2 (Cytochrome b-c1 Complex Subunit 2, Mitochondrial, Complex III Subunit 2, Core Protein II, Ubiquinol-cytochrome-c Reductase Complex Core Protein 2) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UQCRC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UQCRC2 uqcrc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UQCRC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.