Rabbit anti-Human, Mouse UQCRC2 Polyclonal Antibody | anti-UQCRC2 antibody

UQCRC2 (Cytochrome b-c1 Complex Subunit 2, Mitochondrial, Complex III Subunit 2, Core Protein II, Ubiquinol-cytochrome-c Reductase Complex Core Protein 2) (FITC)

Cat. Num. AAA6398087

• Gene Names: UQCRC2; QCR2; UQCR2; MC3DN5
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UQCRC2; Polyclonal Antibody; UQCRC2 (Cytochrome b-c1 Complex Subunit 2; Mitochondrial; Complex III Subunit 2; Core Protein II; Ubiquinol-cytochrome-c Reductase Complex Core Protein 2) (FITC); anti-UQCRC2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human UQCRC2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-UQCRC2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human UQCRC2, aa1-453 (NP_003357.2).
• Immunogen Sequence: MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in human colon.)

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in mouse kidney.)

Western Blot (WB)

(UQCRC2 rabbit polyclonal antibody. Western Blot analysis of UQCRC2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of UQCRC2 expression in transfected 293T cell line by UQCRC2 polyclonal antibody. Lane 1: UQCRC2 transfected lysate (48.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-UQCRC2 antibody

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.

Product Categories/Family for anti-UQCRC2 antibody

Antibodies; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 50592988
• NCBI GeneID: 7385
• NCBI Accession #: NP_003357.2
• NCBI GenBank Nucleotide #: NM_003366.2
• UniProt Accession #: P22695; Q9BQ05; B3KSN4
• Molecular Weight: 48,443 Da
• NCBI Official Full Name: cytochrome b-c1 complex subunit 2, mitochondrial
• NCBI Official Synonym Full Names: ubiquinol-cytochrome c reductase core protein II
• NCBI Official Symbol: UQCRC2
• NCBI Official Synonym Symbols: QCR2; UQCR2; MC3DN5
• NCBI Protein Information: cytochrome b-c1 complex subunit 2, mitochondrial; complex III subunit 2; core protein II; ubiquinol-cytochrome-c reductase complex core protein 2
• UniProt Protein Name: Cytochrome b-c1 complex subunit 2, mitochondrial
• UniProt Gene Name: UQCRC2
• UniProt Entry Name: QCR2_HUMAN

NCBI Description

The protein encoded by this gene is located in the mitochondrion, where it is part of the ubiquinol-cytochrome c reductase complex (also known as complex III). This complex constitutes a part of the mitochondrial respiratory chain. Defects in this gene are a cause of mitochondrial complex III deficiency nuclear type 5. [provided by RefSeq, Jul 2015]

Uniprot Description

UQCRC2: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex. Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.

Protein type: EC 1.10.2.2; Mitochondrial; Oxidoreductase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial respiratory chain complex III

Molecular Function: protein binding; metal ion binding; metalloendopeptidase activity; protein complex binding

Biological Process: cellular metabolic process; aerobic respiration; proteolysis; oxidative phosphorylation

Disease: Mitochondrial Complex Iii Deficiency, Nuclear Type 5