Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UNC93B1 antibody (MBS5300791) used at 5 ug/ml to detect target protein.)

Rabbit UNC93B1 Polyclonal Antibody | anti-UNC93B1 antibody

UNC93B1 antibody

Gene Names
UNC93B1; IIAE1; UNC93; UNC93B; Unc-93B1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
UNC93B1; Polyclonal Antibody; UNC93B1 antibody; Polyclonal UNC93B1; Anti-UNC93B1; UNC93B; UNCB1-93; Unc-93 Homolog B1; MGC126617; UNCB1 93; UNC93; anti-UNC93B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UNC93B1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
505
Applicable Applications for anti-UNC93B1 antibody
Western Blot (WB)
Application Notes
WB: 5 ug/ml
Biological Significance
UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
UNC93B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(UNC93B1 antibody (MBS5300791) used at 5 ug/ml to detect target protein.)

Western Blot (WB) (UNC93B1 antibody (MBS5300791) used at 5 ug/ml to detect target protein.)
Related Product Information for anti-UNC93B1 antibody
Rabbit polyclonal UNC93B1 antibody
Product Categories/Family for anti-UNC93B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
67 kDa (MW of target protein)
NCBI Official Full Name
UNC93B1 protein, partial
NCBI Official Synonym Full Names
unc-93 homolog B1 (C. elegans)
NCBI Official Symbol
UNC93B1
NCBI Official Synonym Symbols
IIAE1; UNC93; UNC93B; Unc-93B1
NCBI Protein Information
protein unc-93 homolog B1
UniProt Protein Name
Protein unc-93 homolog B1
Protein Family
UniProt Gene Name
UNC93B1
UniProt Synonym Gene Names
UNC93; UNC93B; Unc-93B1; hUNC93B1
UniProt Entry Name
UN93B_HUMAN

NCBI Description

This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis. [provided by RefSeq, Feb 2014]

Uniprot Description

UNC93B1: Plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. Required for the transport of a subset of TLRs (including TLR3, TLR7 and TLR9) from the endoplasmic reticulum to endolysosomes where they can engage pathogen nucleotides and activate signaling cascades. May play a role in autoreactive B- cells removal. Defects in UNC93B1 are associated with herpes simplex encephalitis type 1 (HSE1). HSE is a rare complication of human herpesvirus 1 (HHV-1) infection, occurring in only a small minority of HHV-1 infected individuals. HSE is characterized by hemorrhagic necrosis of parts of the temporal and frontal lobes. Onset is over several days and involves fever, headache, seizures, stupor, and often coma, frequently with a fatal outcome. Mutations in UNC93B1 resulting in autosomal recessive UNC93B1 deficieny predispose otherwise healthy individuals to isolated herpes simplex encephalitis due to impaired IFNs production. UNC93B1 deficieny, however, does not compromise immunity to most pathogens, unlike most known primary immunodeficiencies. Belongs to the unc-93 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cell surface

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; endoplasmic reticulum; lysosome; integral to membrane; endosome

Biological Process: intracellular protein transport; toll-like receptor signaling pathway; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class II; toll-like receptor 3 signaling pathway; toll-like receptor 9 signaling pathway; toll-like receptor 7 signaling pathway; defense response to virus

Disease: Herpes Simplex Encephalitis, Susceptibility To, 1

Research Articles on UNC93B1

Similar Products

Product Notes

The UNC93B1 unc93b1 (Catalog #AAA5300791) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNC93B1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UNC93B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 5 ug/ml. Researchers should empirically determine the suitability of the UNC93B1 unc93b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC93B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.