Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (FACS analysis of negative control 293 cells (Black) and ULBP2 expressing 293 cells (Green) using ULBP2 purified mouse polyclonal antibody.)

Mouse anti-Human ULBP2 Polyclonal Antibody | anti-ULBP2 antibody

ULBP2 (UL16-binding Protein 2, ALCAN-alpha, NKG2D Ligand 2, N2DL2, N2DL-2, NKG2DL2, Retinoic Acid Early Transcript 1H, RAET1HORF, UNQ463/PRO791)

Gene Names
ULBP2; N2DL2; RAET1H
Reactivity
Human
Applications
Western Blot, Flow Cytometry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ULBP2; Polyclonal Antibody; ULBP2 (UL16-binding Protein 2; ALCAN-alpha; NKG2D Ligand 2; N2DL2; N2DL-2; NKG2DL2; Retinoic Acid Early Transcript 1H; RAET1HORF; UNQ463/PRO791); Anti -ULBP2 (UL16-binding Protein 2; anti-ULBP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ULBP2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Concentration
0.5mg/ml (varies by lot)
Sequence
MEAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
Applicable Applications for anti-ULBP2 antibody
Western Blot (WB), Flow Cytometry (FC)
Application Notes
Suitable for use in Western Blot and Flow Cytometry.
Other applications not tested.
Optimal dilutions to be determined by the researcher.
Immunogen
Full length protein corresponding to aa 1-246 from human ULBP2.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Flow Cytometry (FC/FACS)

(FACS analysis of negative control 293 cells (Black) and ULBP2 expressing 293 cells (Green) using ULBP2 purified mouse polyclonal antibody.)

Flow Cytometry (FC/FACS) (FACS analysis of negative control 293 cells (Black) and ULBP2 expressing 293 cells (Green) using ULBP2 purified mouse polyclonal antibody.)

Western Blot (WB)

(ULBP2 polyclonal antibody. Western Blot analysis of ULBP2 expression in human ovary cancer.)

Western Blot (WB) (ULBP2 polyclonal antibody. Western Blot analysis of ULBP2 expression in human ovary cancer.)

Western Blot (WB)

(Western Blot analysis of ULBP2 expression in transfected 293T cell line by ULBP2 polyclonal antibody. Lane 1: ULBP2 transfected lysate (27.17kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ULBP2 expression in transfected 293T cell line by ULBP2 polyclonal antibody. Lane 1: ULBP2 transfected lysate (27.17kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ULBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
ULBP2
NCBI Official Synonym Full Names
UL16 binding protein 2
NCBI Official Symbol
ULBP2
NCBI Official Synonym Symbols
N2DL2; RAET1H
NCBI Protein Information
NKG2D ligand 2; N2DL-2; NKG2DL2; ALCAN-alpha; UL16-binding protein 2; retinoic acid early transcript 1H; retinoic acid early transcript 1 H
UniProt Protein Name
NKG2D ligand 2
Protein Family
UniProt Gene Name
ULBP2
UniProt Synonym Gene Names
N2DL2; RAET1H; N2DL-2; NKG2DL2
UniProt Entry Name
N2DL2_HUMAN

NCBI Description

This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6. [provided by RefSeq, Jul 2015]

Uniprot Description

ULBP2: Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP2 to be retained in the ER and cis- Golgi apparatus so that it does not reach the cell surface. Belongs to the MHC class I family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q25

Cellular Component: extracellular space; anchored to plasma membrane; cell surface

Molecular Function: peptide antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; natural killer cell mediated cytotoxicity; natural killer cell activation

Research Articles on ULBP2

Similar Products

Product Notes

The ULBP2 ulbp2 (Catalog #AAA6012056) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ULBP2 (UL16-binding Protein 2, ALCAN-alpha, NKG2D Ligand 2, N2DL2, N2DL-2, NKG2DL2, Retinoic Acid Early Transcript 1H, RAET1HORF, UNQ463/PRO791) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ULBP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Flow Cytometry (FC). Suitable for use in Western Blot and Flow Cytometry. Other applications not tested. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the ULBP2 ulbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEAAAATKIL LCLPLLLLLS GWSRAGRADP HSLCYDITVI PKFRPGPRWC AVQGQVDEKT FLHYDCGNKT VTPVSPLGKK LNVTTAWKAQ NPVLREVVDI LTEQLRDIQL ENYTPKEPLT LQARMSCEQK AEGHSSGSWQ FSFDGQIFLL FDSEKRMWTT VHPGARKMKE KWENDKVVAM SFHYFSMGDC IGWLEDFLMG MDSTLEPSAG APLAMSSGTT QLRATATTLI LCCLLIILPC FILPGI. It is sometimes possible for the material contained within the vial of "ULBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.