Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ULBP1 expression in transfected 293T cell line by ULBP1 MaxPab polyclonal antibody.Lane 1: ULBP1 transfected lysate(28 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human ULBP1 Polyclonal Antibody | anti-ULBP1 antibody

ULBP1 (UL16 Binding Protein 1, RAET1I) (APC)

Gene Names
ULBP1; RAET1I
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ULBP1; Polyclonal Antibody; ULBP1 (UL16 Binding Protein 1; RAET1I) (APC); UL16 Binding Protein 1; RAET1I; anti-ULBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ULBP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ULBP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ULBP1 (NP_079494.1, 1aa-244aa) full-length human protein.
Immunogen Sequence
MASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ULBP1 expression in transfected 293T cell line by ULBP1 MaxPab polyclonal antibody.Lane 1: ULBP1 transfected lysate(28 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ULBP1 expression in transfected 293T cell line by ULBP1 MaxPab polyclonal antibody.Lane 1: ULBP1 transfected lysate(28 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-ULBP1 antibody
Rabbit polyclonal antibody raised against a full-length human ULBP1 protein.
Product Categories/Family for anti-ULBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,997 Da
NCBI Official Full Name
NKG2D ligand 1
NCBI Official Synonym Full Names
UL16 binding protein 1
NCBI Official Symbol
ULBP1
NCBI Official Synonym Symbols
RAET1I
NCBI Protein Information
NKG2D ligand 1; N2DL-1; NKG2DL1; alcan-beta; UL16-binding protein 1; retinoic acid early transcript 1I
UniProt Protein Name
NKG2D ligand 1
Protein Family
UniProt Gene Name
ULBP1
UniProt Synonym Gene Names
N2DL1; RAET1I; N2DL-1; NKG2DL1

Uniprot Description

ULBP1: Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis- Golgi apparatus so that it does not reach the cell surface. Belongs to the MHC class I family.

Protein type: Apoptosis; Cell surface; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: anchored to plasma membrane; plasma membrane

Molecular Function: antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; natural killer cell activation; natural killer cell mediated cytotoxicity; regulation of immune response

Similar Products

Product Notes

The ULBP1 ulbp1 (Catalog #AAA6451807) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ULBP1 (UL16 Binding Protein 1, RAET1I) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ULBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ULBP1 ulbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ULBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.