Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using UGT2B15 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Rabbit UGT2B15 Polyclonal Antibody | anti-UGT2B15 antibody

UGT2B15 Rabbit pAb

Gene Names
UGT2B15; HLUG4; UGT2B8; UDPGTH3; UDPGT 2B8; UDPGT2B15
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
UGT2B15; Polyclonal Antibody; UGT2B15 Rabbit pAb; HLUG4; UDPGT 2B8; UDPGT2B15; UDPGTH3; UGT2B8; anti-UGT2B15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLF
Applicable Applications for anti-UGT2B15 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human UGT2B15 (NP_001067.2).
Positive Samples
HT-29, HepG2, MCF7, BT-474, LO2, mouse liver, rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using UGT2B15 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using UGT2B15 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat kidney using UGT2B15 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat kidney using UGT2B15 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human oophoroma using UGT2B15 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human oophoroma using UGT2B15 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse spleen using UGT2B15 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse spleen using UGT2B15 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-UGT2B15 antibody
Background: This gene encodes a glycosyltransferase that is invovled in the metabolism and elimination of toxic compounts, both endogenous and of xenobiotic origin. This gene plays a role in the regulation of estrogens and androgens. This locus is present in a cluster of similar genes and pseudogenes on chromosome 4.
Product Categories/Family for anti-UGT2B15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,036 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 2B15
NCBI Official Synonym Full Names
UDP glucuronosyltransferase 2 family, polypeptide B15
NCBI Official Symbol
UGT2B15
NCBI Official Synonym Symbols
HLUG4; UGT2B8; UDPGTH3; UDPGT 2B8; UDPGT2B15
NCBI Protein Information
UDP-glucuronosyltransferase 2B15; UDPGTh-3; UDPGT 2B15; UDP glycosyltransferase 2B15; UDP-glucuronosyltransferase 2B8; UDP-glucuronosyltransferase UGT2B15; UDP-glucuronyltransferase, family 2, beta-15
UniProt Protein Name
UDP-glucuronosyltransferase 2B15
UniProt Gene Name
UGT2B15
UniProt Synonym Gene Names
UGT2B8; UDPGT 2B15; UDPGT 2B8
UniProt Entry Name
UDB15_HUMAN

NCBI Description

This gene encodes a member of the UDP-glycosyltransferase (UDPGT) family. The UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein displays activity towards several classes of xenobiotic substrates, including simple phenolic compounds, 7-hydroxylated coumarins, flavonoids, anthraquinones, and certain drugs and their hydroxylated metabolites. It also catalyzes the glucuronidation of endogenous estrogens and androgens. [provided by RefSeq, Oct 2011]

Uniprot Description

UGT2B15: UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme displays activity toward several classes of xenobiotic substrates, including simple phenolic compounds, 7-hydroxylated coumarins, flavonoids, anthraquinones, and certain drugs and their hydroxylated metabolites. It also catalyzes the glucuronidation of endogenous estrogens and androgens. Belongs to the UDP-glycosyltransferase family.

Protein type: Transferase; EC 2.4.1.17; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Carbohydrate Metabolism - ascorbate and aldarate; Carbohydrate Metabolism - pentose and glucuronate interconversions; Carbohydrate Metabolism - starch and sucrose; Xenobiotic Metabolism - drug metabolism - other enzymes; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Lipid Metabolism - androgen and estrogen; Membrane protein, integral; Cofactor and Vitamin Metabolism - retinol; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 4q13

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; integral to membrane

Molecular Function: retinoic acid binding; glucuronosyltransferase activity

Biological Process: steroid metabolic process; flavonoid biosynthetic process; xenobiotic metabolic process; cellular response to hormone stimulus

Research Articles on UGT2B15

Similar Products

Product Notes

The UGT2B15 ugt2b15 (Catalog #AAA9142395) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGT2B15 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UGT2B15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the UGT2B15 ugt2b15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASTLVNASKS SAIKLEVYPT SLTKNYLEDS LLKILDRWIY GVSKNTFWSY FSQLQELCWE YYDYSNKLCK DAVLNKKLMM KLQESKFDVI LADALNPCGE LLAELFNIPF LYSLRFSVGY TFEKNGGGFL F. It is sometimes possible for the material contained within the vial of "UGT2B15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.