Western Blot (WB)
(Host: RabbitTarget Name: UGT2A1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human UGT2A1 Polyclonal Antibody | anti-UGT2A1 antibody
UGT2A1 Antibody - middle region
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UGT2A1; Polyclonal Antibody; UGT2A1 Antibody - middle region; anti-UGT2A1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: RVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQE
Sequence Length
693
Applicable Applications for anti-UGT2A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UGT2A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UGT2A1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UGT2A1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UGT2A1 antibody
The protein encoded by this gene belongs to the UDP-glycosyltransferase family, members of which catalyze biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This enzyme is expressed in the olfactory neuroepithelium, which lines the posterior nasal cavity and is exposed to a wide range of odorants and airborne toxic compounds. Hence, this protein has been suggested to be involved in clearing lipophilic odorant molecules from the sensory epithelium. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. This gene shares exon structure with the UDP glucuronosyltransferase 2A2 family member, which encodes N-terminally distinct isoforms.
Product Categories/Family for anti-UGT2A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76 kDa
NCBI Official Full Name
UDP-glucuronosyltransferase 2A2 isoform UGT2A2_i1
NCBI Official Synonym Full Names
UDP glucuronosyltransferase family 2 member A2
NCBI Official Symbol
UGT2A2
NCBI Protein Information
UDP-glucuronosyltransferase 2A2
UniProt Protein Name
UDP-glucuronosyltransferase 2A1
Protein Family
UniProt Gene Name
UGT2A1
UniProt Synonym Gene Names
UGT2A2; UDPGT 2A1
UniProt Entry Name
UD2A1_HUMAN
Research Articles on UGT2A1
Similar Products
Product Notes
The UGT2A1 ugt2a1 (Catalog #AAA3221072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGT2A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UGT2A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UGT2A1 ugt2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVPFGKERIE GVIKDFVLTW LENRPSPSTI WRFYQEMAKV IKDFHMVSQE. It is sometimes possible for the material contained within the vial of "UGT2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
