Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Uchl3Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Uchl3 Polyclonal Antibody | anti-UCHL3 antibody

Uchl3 Antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Uchl3; Polyclonal Antibody; Uchl3 Antibody - middle region; anti-UCHL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET
Sequence Length
230
Applicable Applications for anti-UCHL3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Uchl3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Uchl3Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Uchl3Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UCHL3 antibody
This is a rabbit polyclonal antibody against Uchl3. It was validated on Western Blot

Target Description: Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Uchl3 has a 10-fold preference for Arg and Lys at position P3", and exhibits a preference towards 'Lys-48'-linked Ubiquitin chains. Uchl3 deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Uchl3 indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. It is required for stress-response retinal, skeletal muscle and germ cell maintenance. Uchl3 may be involved in working memory and can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome.
Product Categories/Family for anti-UCHL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase isozyme L3
NCBI Official Synonym Full Names
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
NCBI Official Symbol
Uchl3
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase isozyme L3
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase isozyme L3
UniProt Gene Name
Uchl3
UniProt Synonym Gene Names
UCH-L3

Uniprot Description

UCHL3: Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin- signaling and insulin-induced adipogenesis. Required for stress- response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders. Preferentially binds diubiquitin; the interaction does not hydrolyze diubiquitin but, in vitro, inhibits the hydrolyzing activity on other substrates. Highly expressed in heart, skeletal muscle, and testis. Inhibited by monoubiquitin and diubiquitin. Belongs to the peptidase C12 family.

Protein type: EC 3.4.19.12; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 14 E2.3|14 50.9 cM

Cellular Component: cytoplasm; nucleus

Molecular Function: peptidase activity; ubiquitin binding; ubiquitin-specific protease activity

Biological Process: adult walking behavior; cellular response to insulin stimulus; eating behavior; positive regulation of fat cell differentiation; protein catabolic process; protein deubiquitination; retina development in camera-type eye

Research Articles on UCHL3

Similar Products

Product Notes

The UCHL3 uchl3 (Catalog #AAA3214276) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Uchl3 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Uchl3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UCHL3 uchl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHAIANNKDK MHFESGSTLK KFLEESVSMS PEERAKFLEN YDAIRVTHET. It is sometimes possible for the material contained within the vial of "Uchl3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.