Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateUBN1 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit UBN1 Polyclonal Antibody | anti-UBN1 antibody

UBN1 antibody - C-terminal region

Gene Names
UBN1; VT; VT4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBN1; Polyclonal Antibody; UBN1 antibody - C-terminal region; anti-UBN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM
Sequence Length
1134
Applicable Applications for anti-UBN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human UBN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateUBN1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-UBN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateUBN1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-UBN1 antibody
This is a rabbit polyclonal antibody against UBN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBN1 may be required for replication-independent chromatin assembly.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121kDa
NCBI Official Synonym Full Names
ubinuclein 1
NCBI Official Symbol
UBN1
NCBI Official Synonym Symbols
VT; VT4
NCBI Protein Information
ubinuclein-1
UniProt Protein Name
Ubinuclein-1
Protein Family
UniProt Gene Name
UBN1
UniProt Entry Name
UBN1_HUMAN

NCBI Description

Cellular senescence is a hallmark of tumor suppression and tissue aging. Senescent cells contain domains of heterochromatin, called senescence-associated heterochromatin foci (SAHF), that repress proliferation-promoting genes. The protein encoded by this gene binds to proliferation-promoting genes and is required for SAHF formation, enhancing methylation of histone H3. [provided by RefSeq, Oct 2016]

Uniprot Description

UBN1: a transcriptional regulator that interacts with the basic domain of the viral and cellular bZIP transcription factors including c-Jun and epstein-barr virus proteins BZLF1 and CEBPA.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; nucleus; PML body; tight junction

Molecular Function: DNA binding; protein binding; transcription factor activity

Biological Process: chromatin modification; DNA replication-independent nucleosome assembly; regulation of transcription from RNA polymerase II promoter; viral reproduction

Research Articles on UBN1

Similar Products

Product Notes

The UBN1 ubn1 (Catalog #AAA3208679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBN1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBN1 ubn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGDSSGGTQG VAKLLTSPSL KPSAVSSVTS STSLSKGASG TVLLAGSSLM. It is sometimes possible for the material contained within the vial of "UBN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.