Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UBL4A expression in transfected 293T cell line by UBL4A polyclonal antibody. Lane 1: UBL4A transfected lysate (17.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human UBL4A Polyclonal Antibody | anti-UBL4A antibody

UBL4A (Ubiquitin-Like 4A, DX254E, DXS254E, G6PD, GDX, UBL4) (AP)

Gene Names
UBL4A; GDX; G6PD; GET5; MDY2; UBL4; TMA24; DX254E; DXS254E
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBL4A; Polyclonal Antibody; UBL4A (Ubiquitin-Like 4A; DX254E; DXS254E; G6PD; GDX; UBL4) (AP); anti-UBL4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBL4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-UBL4A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UBL4A, aa1-157 (NP_055050.1).
Immunogen Sequence
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBL4A expression in transfected 293T cell line by UBL4A polyclonal antibody. Lane 1: UBL4A transfected lysate (17.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBL4A expression in transfected 293T cell line by UBL4A polyclonal antibody. Lane 1: UBL4A transfected lysate (17.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-UBL4A antibody
The UBL4 gene lies in a ubiquitiously transcribed region on the X chromosome approximately 40kb downstream of glucose-6-phosphate dehydrogenase (G6PD). The UBL4 gene, which encodes for a 157aa protein, is consistent with the characteristics of a housekeeping gene, since transcripts are detected a multiple cell types, and the protomoter region is rich in GC sequences and lacks signals such as TATA and CAT boxes. The UBL4 protein bears strong similarity in its 72 N-terminal aa to ubiquitin. In the middle of the C-terminus moiety of the UBL4 protein, similarities to the thyroglobulin hormonogenic site, the sequence that surrounds the tyrosines that will form thyroxine, have been demonstrated. It has been inferred from these data that the UBL4 protein plays an important role in essential cellular functions.
Product Categories/Family for anti-UBL4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,777 Da
NCBI Official Full Name
ubiquitin-like protein 4A
NCBI Official Synonym Full Names
ubiquitin-like 4A
NCBI Official Symbol
UBL4A
NCBI Official Synonym Symbols
GDX; G6PD; GET5; MDY2; UBL4; TMA24; DX254E; DXS254E
NCBI Protein Information
ubiquitin-like protein 4A; ubiquitin-like 4; ubiquitin-like protein GDX
UniProt Protein Name
Ubiquitin-like protein 4A
Protein Family
UniProt Gene Name
UBL4A
UniProt Synonym Gene Names
DXS254E; GDX; UBL4
UniProt Entry Name
UBL4A_HUMAN

Uniprot Description

UBL4A: Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytosol

Molecular Function: protein binding; small conjugating protein ligase activity

Biological Process: transport; protein modification process

Research Articles on UBL4A

Similar Products

Product Notes

The UBL4A ubl4a (Catalog #AAA6397897) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBL4A (Ubiquitin-Like 4A, DX254E, DXS254E, G6PD, GDX, UBL4) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBL4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBL4A ubl4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBL4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.