Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UBD expression in transfected 293T cell line by UBD polyclonal antibody. Lane 1: UBD transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Ubiquitin D Polyclonal Antibody | anti-UBD antibody

Ubiquitin D (UBD, Diubiquitin, GABBR1, Ubiquitin-like Protein FAT10, FAT10, UBD-3) (HRP)

Gene Names
UBD; FAT10; UBD-3; GABBR1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Ubiquitin D; Polyclonal Antibody; Ubiquitin D (UBD; Diubiquitin; GABBR1; Ubiquitin-like Protein FAT10; FAT10; UBD-3) (HRP); anti-UBD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
894
Applicable Applications for anti-UBD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human UBD, aa1-165 (NP_006389.1).
Immunogen Sequence
MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBD expression in transfected 293T cell line by UBD polyclonal antibody. Lane 1: UBD transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBD expression in transfected 293T cell line by UBD polyclonal antibody. Lane 1: UBD transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-UBD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitin D (UBD), mRNA
NCBI Official Synonym Full Names
ubiquitin D
NCBI Official Symbol
UBD
NCBI Official Synonym Symbols
FAT10; UBD-3; GABBR1
NCBI Protein Information
ubiquitin D
UniProt Protein Name
Ubiquitin D
Protein Family
UniProt Gene Name
UBD
UniProt Synonym Gene Names
FAT10
UniProt Entry Name
UBD_HUMAN

NCBI Description

This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types. [provided by RefSeq, Aug 2017]

Uniprot Description

FAT10: Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)- associated nephropathy (HIVAN).

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein modification by small protein conjugation; positive regulation of apoptosis; protein ubiquitination; myeloid dendritic cell differentiation; proteolysis; response to organic nitrogen

Research Articles on UBD

Similar Products

Product Notes

The UBD ubd (Catalog #AAA6397824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ubiquitin D (UBD, Diubiquitin, GABBR1, Ubiquitin-like Protein FAT10, FAT10, UBD-3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ubiquitin D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBD ubd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ubiquitin D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.