Western Blot (WB)
(Host: RabbitTarget Name: UBE2SSample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse UBE2S Polyclonal Antibody | anti-UBE2S antibody
UBE2S Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE2S; Polyclonal Antibody; UBE2S Antibody-C-terminal region; ubiquitin-conjugating enzyme E2 S; E2-EPF; AA409170; 0910001J09Rik; 6720465F12Rik; anti-UBE2S antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
GRAEATQDLASGASASSADPMIPGVLGGAEGPMAKKHAGERDKKLAAKKK
Applicable Applications for anti-UBE2S antibody
Western Blot (WB)
Protein Size
223 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2S
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UBE2SSample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UBE2SSample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBE2S antibody
Description of Target: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
24kDa
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 S
Protein Family
UniProt Gene Name
Ube2s
UniProt Synonym Gene Names
E2epf
UniProt Entry Name
UBE2S_MOUSE
Similar Products
Product Notes
The UBE2S ube2s (Catalog #AAA3249854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2S Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2S can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2S ube2s for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRAEATQDLA SGASASSADP MIPGVLGGAE GPMAKKHAGE RDKKLAAKKK. It is sometimes possible for the material contained within the vial of "UBE2S, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
