Western Blot (WB)
(UBE2G2 rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.)
Rabbit anti-Human, Mouse UBE2G2 Polyclonal Antibody | anti-UBE2G2 antibody
UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (HRP)
Gene Names
UBE2G2; UBC7
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2G2; Polyclonal Antibody; UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2; Ubiquitin Carrier Protein G2; Ubiquitin-protein Ligase G2; UBC7) (HRP); EC=6.3.2.19; anti-UBE2G2 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBE2G2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-UBE2G2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UBE2G2, aa1-137 (NP_872630.1).
Immunogen Sequence
MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(UBE2G2 rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.)
Western Blot (WB)
(UBE2G2 rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in mouse kidney.)
Western Blot (WB)
(UBE2G2 rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in Jurkat.)
Western Blot (WB)
(UBE2G2 rabbit polyclonal antibody. Western Blot analysis of UBE2G2 expression in Jurkat.)
Product Categories/Family for anti-UBE2G2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15,614 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 G2 isoform 2
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 G2
NCBI Official Symbol
UBE2G2
NCBI Official Synonym Symbols
UBC7
NCBI Protein Information
ubiquitin-conjugating enzyme E2 G2
Protein Family
NCBI Description
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Research Articles on UBE2G2
Similar Products
Product Notes
The UBE2G2 (Catalog #AAA6397835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2G2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2G2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2G2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
