Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBE2ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human UBE2A Polyclonal Antibody | anti-UBE2A antibody

UBE2A Antibody - middle region

Gene Names
UBE2A; UBC2; HHR6A; MRXSN; RAD6A; MRXS30
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBE2A; Polyclonal Antibody; UBE2A Antibody - middle region; anti-UBE2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQL
Sequence Length
152
Applicable Applications for anti-UBE2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBE2ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBE2ASample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UBE2A antibody
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with mental retardation. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-UBE2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 A isoform 4
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 A
NCBI Official Symbol
UBE2A
NCBI Official Synonym Symbols
UBC2; HHR6A; MRXSN; RAD6A; MRXS30
NCBI Protein Information
ubiquitin-conjugating enzyme E2 A
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 A
UniProt Gene Name
UBE2A
UniProt Synonym Gene Names
RAD6A; HR6A; hHR6A
UniProt Entry Name
UBE2A_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

UBE2A: a ubiquitin-protein ligase, a member of the ubiquitin-conjugating enzyme family. Homologous to the yeast DNA repair gene RAD6. Interacts with RAD18. Required for postreplication repair of UV-damaged DNA.

Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase; Ligase

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: XY body; cytoplasm; nuclear chromatin; chromatin; cytosol

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of peptide antigen via MHC class I; protein autoubiquitination; protein polyubiquitination; maternal process involved in pregnancy; postreplication repair; in utero embryonic development; positive regulation of cell proliferation; DNA repair; histone H2A ubiquitination; response to UV

Disease: Mental Retardation, X-linked, Syndromic, Nascimento Type

Research Articles on UBE2A

Similar Products

Product Notes

The UBE2A ube2a (Catalog #AAA3220862) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2A ube2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVYADGSICL DILQNRWSPT YDVSSILTSI QSLLDEPNPN SPANSQAAQL. It is sometimes possible for the material contained within the vial of "UBE2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.