Western Blot (WB)
(Host: RabbitTarget Name: UBAC1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human UBAC1 Polyclonal Antibody | anti-UBAC1 antibody
UBAC1 Antibody - middle region
Gene Names
UBAC1; KPC2; GBDR1; UBADC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBAC1; Polyclonal Antibody; UBAC1 Antibody - middle region; anti-UBAC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRAT
Sequence Length
405
Applicable Applications for anti-UBAC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBAC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UBAC1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UBAC1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBAC1 antibody
Non-catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle.
Product Categories/Family for anti-UBAC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
ubiquitin-associated domain-containing protein 1
NCBI Official Synonym Full Names
UBA domain containing 1
NCBI Official Symbol
UBAC1
NCBI Official Synonym Symbols
KPC2; GBDR1; UBADC1
NCBI Protein Information
ubiquitin-associated domain-containing protein 1
UniProt Protein Name
Ubiquitin-associated domain-containing protein 1
Protein Family
UniProt Gene Name
UBAC1
UniProt Synonym Gene Names
GBDR1; KPC2; UBADC1; UBA domain-containing protein 1
UniProt Entry Name
UBAC1_HUMAN
Uniprot Description
UBAC1: Non-catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle.
Chromosomal Location of Human Ortholog: 9q34.3
Cellular Component: Golgi apparatus; cytoplasm; plasma membrane
Molecular Function: protein binding
Biological Process: protein ubiquitination
Research Articles on UBAC1
Similar Products
Product Notes
The UBAC1 ubac1 (Catalog #AAA3222224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBAC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBAC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBAC1 ubac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEENIQDQDV LLLIKKRAPS PLPKMADVSA EEKKKQDQKA PDKEAILRAT. It is sometimes possible for the material contained within the vial of "UBAC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
