Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Rat lung, using UBA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Rat UBA2 Polyclonal Antibody | anti-UBA2 antibody

UBA2 Rabbit pAb

Gene Names
UBA2; ARX; SAE2; HRIHFB2115
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
UBA2; Polyclonal Antibody; UBA2 Rabbit pAb; ARX; HRIHFB2115; SAE2; anti-UBA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, pH7.3.
Sequence
QFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
Applicable Applications for anti-UBA2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human UBA2 (NP_005490.1).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Rat lung, using UBA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of Rat lung, using UBA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,224 Da
NCBI Official Full Name
SUMO-activating enzyme subunit 2
NCBI Official Synonym Full Names
ubiquitin-like modifier activating enzyme 2
NCBI Official Symbol
UBA2
NCBI Official Synonym Symbols
ARX; SAE2; HRIHFB2115
NCBI Protein Information
SUMO-activating enzyme subunit 2; SUMO1 activating enzyme subunit 2; SUMO-1 activating enzyme subunit 2; ubiquitin-like 1-activating enzyme E1B; anthracycline-associated resistance ARX; UBA2, ubiquitin-activating enzyme E1 homolog
UniProt Protein Name
SUMO-activating enzyme subunit 2
UniProt Gene Name
UBA2
UniProt Synonym Gene Names
SAE2; UBLE1B
UniProt Entry Name
SAE2_HUMAN

NCBI Description

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 (MIM 613294) and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]

Uniprot Description

SAE2: a protein of the ubiquitin-activating E1 family. Acts as a UBL1 E1 ligase. Mediates ATP-dependent activation of UBL1 and formation of a thiolester with a conserved cysteine residue on SAE2.

Protein type: Ligase; EC 6.3.2.19; Ubiquitin conjugating system; EC 6.3.2.-; Motility/polarity/chemotaxis; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 19q12

Cellular Component: nucleoplasm; nucleus; cytosol

Molecular Function: SUMO activating enzyme activity; protein binding; protein heterodimerization activity; metal ion binding; enzyme activator activity; transcription factor binding; ATP binding

Biological Process: positive regulation of catalytic activity; cellular protein metabolic process; protein sumoylation; SMT3-dependent protein catabolic process; post-translational protein modification

Research Articles on UBA2

Similar Products

Product Notes

The UBA2 uba2 (Catalog #AAA9142729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBA2 Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:1000. Researchers should empirically determine the suitability of the UBA2 uba2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QFLFQKKHVG RSKAQVAKES VLQFYPKANI VAYHDSIMNP DYNVEFFRQF ILVMNALDNR AARNHVNRMC LAADVPLIES GTAGYLGQVT TIKKGVTECY E. It is sometimes possible for the material contained within the vial of "UBA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.