Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TXNIPSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TXNIP is expressed in Jurkat)

Rabbit TXNIP Polyclonal Antibody | anti-TXNIP antibody

TXNIP Antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TXNIP; Polyclonal Antibody; TXNIP Antibody - N-terminal region; anti-TXNIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSF
Sequence Length
391
Applicable Applications for anti-TXNIP antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 87%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TXNIPSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TXNIP is expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: TXNIPSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TXNIP is expressed in Jurkat)
Related Product Information for anti-TXNIP antibody
This is a rabbit polyclonal antibody against TXNIP. It was validated on Western Blot

Target Description: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
UniProt Protein Name
Thioredoxin-interacting protein
UniProt Gene Name
TXNIP
UniProt Synonym Gene Names
VDUP1
UniProt Entry Name
TXNIP_HUMAN

Uniprot Description

TXNIP: May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over- expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Belongs to the arrestin family.

Protein type: Tumor suppressor; Motility/polarity/chemotaxis; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: cytoplasm; mitochondrial intermembrane space; cytosol; nucleus

Molecular Function: enzyme inhibitor activity; protein binding; ubiquitin protein ligase binding

Biological Process: response to drug; transcription, DNA-dependent; positive regulation of apoptosis; platelet-derived growth factor receptor signaling pathway; negative regulation of cell division; negative regulation of transcription from RNA polymerase II promoter; cell cycle; response to estradiol stimulus; regulation of cell proliferation; keratinocyte differentiation; response to hydrogen peroxide; response to mechanical stimulus; protein import into nucleus; negative regulation of catalytic activity; response to glucose stimulus; innate immune response; response to calcium ion; response to progesterone stimulus

Similar Products

Product Notes

The TXNIP txnip (Catalog #AAA3214166) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TXNIP Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TXNIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TXNIP txnip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTSEYLRYED TLLLEDQPTG ENEMVIMRPG NKYEYKFGFE LPQGPLGTSF. It is sometimes possible for the material contained within the vial of "TXNIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.