Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TXNDC12Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TXNDC12 Polyclonal Antibody | anti-TXNDC12 antibody

TXNDC12 Antibody - N-terminal region

Gene Names
TXNDC12; AG1; AGR1; ERP16; ERP18; ERP19; TLP19; hAG-1; PDIA16; hTLP19
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TXNDC12; Polyclonal Antibody; TXNDC12 Antibody - N-terminal region; anti-TXNDC12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA
Sequence Length
172
Applicable Applications for anti-TXNDC12 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TXNDC12Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TXNDC12Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TXNDC12 antibody
This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
Product Categories/Family for anti-TXNDC12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
thioredoxin domain-containing protein 12
NCBI Official Synonym Full Names
thioredoxin domain containing 12
NCBI Official Symbol
TXNDC12
NCBI Official Synonym Symbols
AG1; AGR1; ERP16; ERP18; ERP19; TLP19; hAG-1; PDIA16; hTLP19
NCBI Protein Information
thioredoxin domain-containing protein 12
UniProt Protein Name
Thioredoxin domain-containing protein 12
UniProt Gene Name
TXNDC12
UniProt Synonym Gene Names
TLP19; ER protein 18; ERp18; ER protein 19; ERp19
UniProt Entry Name
TXD12_HUMAN

NCBI Description

This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Mar 2012]

Uniprot Description

TXNDC12: Possesses significant protein thiol-disulfide oxidase activity.

Protein type: EC 1.8.4.2; Secreted; Other Amino Acids Metabolism - glutathione; Secreted, signal peptide; Oxidoreductase

Chromosomal Location of Human Ortholog: 1p32.3

Cellular Component: endoplasmic reticulum lumen

Molecular Function: protein-disulfide reductase (glutathione) activity

Biological Process: cell redox homeostasis

Research Articles on TXNDC12

Similar Products

Product Notes

The TXNDC12 txndc12 (Catalog #AAA3220919) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TXNDC12 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TXNDC12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TXNDC12 txndc12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: METRPRLGAT CLLGFSFLLL VISSDGHNGL GKGFGDHIHW RTLEDGKKEA. It is sometimes possible for the material contained within the vial of "TXNDC12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.