Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TUBG1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TUBG1 Polyclonal Antibody | anti-TUBG1 antibody

TUBG1 Antibody - middle region

Gene Names
TUBG1; TUBG; GCP-1; CDCBM4; TUBGCP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TUBG1; Polyclonal Antibody; TUBG1 Antibody - middle region; anti-TUBG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIH
Sequence Length
451
Applicable Applications for anti-TUBG1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TUBG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TUBG1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TUBG1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TUBG1 antibody
This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.
Product Categories/Family for anti-TUBG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
tubulin gamma-1 chain
NCBI Official Synonym Full Names
tubulin gamma 1
NCBI Official Symbol
TUBG1
NCBI Official Synonym Symbols
TUBG; GCP-1; CDCBM4; TUBGCP1
NCBI Protein Information
tubulin gamma-1 chain
UniProt Protein Name
Tubulin gamma-1 chain
UniProt Gene Name
TUBG1
UniProt Synonym Gene Names
TUBG; GCP-1
UniProt Entry Name
TBG1_HUMAN

NCBI Description

This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7. [provided by RefSeq, Jan 2009]

Uniprot Description

TUBG1: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta tubulin minus-end nucleation, centrosome duplication and spindle formation. Interacts with GCP2 and GCP3. Interacts with B9D2. Interacts with CDK5RAP2; the interaction is leading to centrosomal localization of TUBG1 and CDK5RAP2. Interacts with PIFO/C1orf88. Belongs to the tubulin family.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: centriole; centrosome; recycling endosome; pericentriolar material; condensed nuclear chromosome; cytoplasmic microtubule; nonmotile primary cilium; apical part of cell; cytoplasm; leading edge; polar microtubule; cytosol; gamma-tubulin complex

Molecular Function: GTPase activity; protein binding; GTP binding; structural constituent of cytoskeleton

Biological Process: metabolic process; organelle organization and biogenesis; mitotic cell cycle; microtubule cytoskeleton organization and biogenesis; microtubule nucleation; G2/M transition of mitotic cell cycle; cytoplasmic microtubule organization and biogenesis; meiotic spindle organization and biogenesis

Disease: Cortical Dysplasia, Complex, With Other Brain Malformations 4

Research Articles on TUBG1

Similar Products

Product Notes

The TUBG1 tubg1 (Catalog #AAA3222691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBG1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TUBG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TUBG1 tubg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLDLEPRVIH SILNSPYAKL YNPENIYLSE HGGGAGNNWA SGFSQGEKIH. It is sometimes possible for the material contained within the vial of "TUBG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.