Western Blot (WB)
(WB Suggested Anti-TTC5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit TTC5 Polyclonal Antibody | anti-TTC5 antibody
TTC5 antibody - C-terminal region
Gene Names
TTC5; Strap
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TTC5; Polyclonal Antibody; TTC5 antibody - C-terminal region; anti-TTC5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
Sequence Length
440
Applicable Applications for anti-TTC5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TTC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TTC5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TTC5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-TTC5 antibody
This is a rabbit polyclonal antibody against TTC5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
Target Description: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
Product Categories/Family for anti-TTC5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
tetratricopeptide repeat protein 5
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 5
NCBI Official Symbol
TTC5
NCBI Official Synonym Symbols
Strap
NCBI Protein Information
tetratricopeptide repeat protein 5
UniProt Protein Name
Tetratricopeptide repeat protein 5
Protein Family
UniProt Gene Name
TTC5
UniProt Synonym Gene Names
TPR repeat protein 5; Strap
UniProt Entry Name
TTC5_HUMAN
Uniprot Description
TTC5: Adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. Required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. Prevents p53/TP53 degradation by MDM2.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 14q11.2
Cellular Component: nucleoplasm; cytoplasm
Molecular Function: DNA binding; chromatin binding
Biological Process: positive regulation of transcription from RNA polymerase II promoter; DNA repair
Research Articles on TTC5
Similar Products
Product Notes
The TTC5 ttc5 (Catalog #AAA3209282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TTC5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TTC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TTC5 ttc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDSVAIPEPN LRLHRIQHKG KDYSFSSVRV ETPLLLVVNG KPQGSSSQAV. It is sometimes possible for the material contained within the vial of "TTC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
