Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPYL2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit TSPYL2 Polyclonal Antibody | anti-TSPYL2 antibody
TSPYL2 Polyclonal Antibody
Gene Names
TSPYL2; CDA1; CTCL; NP79; TSPX; CINAP; DENTT; SE204; HRIHFB2216
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TSPYL2; Polyclonal Antibody; TSPYL2 Polyclonal Antibody; CDA1; CINAP; CTCL; DENTT; HRIHFB2216; NP79; SE204; TSPX; anti-TSPYL2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTD
Sequence Length
693
Applicable Applications for anti-TSPYL2 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human TSPYL2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Positive Samples
LO2, HeLa, Mouse brain, Mouse testis, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPYL2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPYL2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-TSPYL2 antibody
This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth.
Product Categories/Family for anti-TSPYL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 79kDa
Observed: 110kDa
Observed: 110kDa
NCBI Official Full Name
testis-specific Y-encoded-like protein 2
NCBI Official Synonym Full Names
TSPY like 2
NCBI Official Symbol
TSPYL2
NCBI Official Synonym Symbols
CDA1; CTCL; NP79; TSPX; CINAP; DENTT; SE204; HRIHFB2216
NCBI Protein Information
testis-specific Y-encoded-like protein 2
UniProt Protein Name
Testis-specific Y-encoded-like protein 2
Protein Family
UniProt Gene Name
TSPYL2
UniProt Synonym Gene Names
CDA1; DENTT; TSPX; TSPY-like protein 2; CTCL-associated antigen se20-4; NP79
NCBI Description
This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth. [provided by RefSeq, Sep 2009]
Uniprot Description
Part of the CASK/TBR1/TSPYL2 transcriptional complex which modulates gene expression in response to neuronal synaptic activity, probably by facilitating nucleosome assembly. May inhibit cell proliferation by inducing p53-dependent CDKN1A expression.
Research Articles on TSPYL2
Similar Products
Product Notes
The TSPYL2 tspyl2 (Catalog #AAA9133166) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSPYL2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSPYL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the TSPYL2 tspyl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKRKFIQMRR PFLERRDLII QHIPGFWVKA FLNHPRISIL INRRDEDIFR YLTNLQVQDL RHISMGYKMK LYFQTNPYFT NMVIVKEFQR NRSGRLVSHS TPIRWHRGQE PQARRHGNQD ASHSFFSWFS NHSLPEADRI AEIIKNDLWV NPLRYYLRER GSRIKRKKQE MKKRKTRGRC EVVIMEDAPD YYAVEDIFSE ISDIDETIHD IKISDFMETT D. It is sometimes possible for the material contained within the vial of "TSPYL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
