Western Blot (WB)
(WB Suggested Anti-TRSPAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Intestine)
Rabbit TRSPAP1 Polyclonal Antibody | anti-TRNAU1AP antibody
TRSPAP1 antibody - N-terminal region
Gene Names
TRNAU1AP; SECP43; PRO1902; TRSPAP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRSPAP1; Polyclonal Antibody; TRSPAP1 antibody - N-terminal region; anti-TRNAU1AP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
Sequence Length
287
Applicable Applications for anti-TRNAU1AP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRSPAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRSPAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Intestine)
Western Blot (WB)
(WB Suggested Anti-TRSPAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Intestine)
Related Product Information for anti-TRNAU1AP antibody
This is a rabbit polyclonal antibody against TRSPAP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRSPAP1 is involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. It stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. It may be involved in the methylation of tRNA(Sec) and enhances efficiency of selenoproteins synthesis.
Target Description: TRSPAP1 is involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. It stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. It may be involved in the methylation of tRNA(Sec) and enhances efficiency of selenoproteins synthesis.
Product Categories/Family for anti-TRNAU1AP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
tRNA selenocysteine 1-associated protein 1
NCBI Official Synonym Full Names
tRNA selenocysteine 1 associated protein 1
NCBI Official Symbol
TRNAU1AP
NCBI Official Synonym Symbols
SECP43; PRO1902; TRSPAP1
NCBI Protein Information
tRNA selenocysteine 1-associated protein 1
UniProt Protein Name
tRNA selenocysteine 1-associated protein 1
Protein Family
UniProt Gene Name
TRNAU1AP
UniProt Synonym Gene Names
SECP43; TRSPAP1
UniProt Entry Name
TSAP1_HUMAN
Uniprot Description
Function: Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. May be involved in the methylation of tRNA(Sec). Enhances efficiency of selenoproteins synthesis
By similarity. Ref.5
Subunit structure: Component of the tRNA(Sec) complex composed at least of EEFSEC, SECISBP2, SEPHS1, SEPSECS, TRNAU1AP and tRNA(Sec). Found in a complex with tRNA(Sec). Interacts with SEPSECS. Associates with mRNP and/or polysomes
By similarity. Found in a complex with EEFSEC, SECISBP2, TRNAU1AP and tRNA(Sec). Ref.5
Subcellular location: Nucleus
By similarity. Cytoplasm
By similarity. Note: Abundant in the nucleus
By similarity.
Sequence similarities: Belongs to the RRM TRSPAP family.Contains 2 RRM (RNA recognition motif) domains.
Research Articles on TRNAU1AP
Similar Products
Product Notes
The TRNAU1AP trnau1ap (Catalog #AAA3205524) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRSPAP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRSPAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRNAU1AP trnau1ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGATPAKRFK LNYATYGKQP DNSPEYSLFV GDLTPDVDDG MLYEFFVKVY. It is sometimes possible for the material contained within the vial of "TRSPAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
