Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- TRPV5 Picoband antibody, MBS178072, Western blottingAll lanes: Anti TRPV5 (MBS178072) at 0.5ug/mlLane 1: Rat Pancreas Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: Rat Intestine Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugLane 6: 293T Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD)

anti-Human, Rat TRPV5 Polyclonal Antibody | anti-TRPV5 antibody

Anti-TRPV5 Antibody

Gene Names
TRPV5; CAT2; ECAC1; OTRPC3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TRPV5; Polyclonal Antibody; Anti-TRPV5 Antibody; Transient receptor potential cation channel subfamily V member 5; Calcium transport protein 2; Calcium transporter 2; CAT 2; CAT2; ECAC 1; ECaC; ECAC1; Epithelial calcium channel 1; Osm 9 like TRP channel 3; Osm-9-like TRP channel 3; OTRPC 3; OTRPC3; TRPV 5; TrpV5; TRPV5_HUMAN; transient receptor potential cation channel; subfamily V; member 5; anti-TRPV5 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
729
Applicable Applications for anti-TRPV5 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- TRPV5 Picoband antibody, MBS178072, Western blottingAll lanes: Anti TRPV5 (MBS178072) at 0.5ug/mlLane 1: Rat Pancreas Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: Rat Intestine Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugLane 6: 293T Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD)

Western Blot (WB) (Anti- TRPV5 Picoband antibody, MBS178072, Western blottingAll lanes: Anti TRPV5 (MBS178072) at 0.5ug/mlLane 1: Rat Pancreas Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: Rat Intestine Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: COLO320 Whole Cell Lysate at 40ugLane 6: 293T Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD)
Related Product Information for anti-TRPV5 antibody
Description: Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human;Rat.

Background: Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
References
1. Clapham DE, Julius D, Montell C, Schultz G (Dec 2005). "International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels".Pharmacol. Rev. 57 (4): 427-50. 2. Müller D, Hoenderop JG, Meij IC, van den Heuvel LP, Knoers NV, den Hollander AI et al. (Nov 2000). "Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2+ channel (ECAC1)". Genomics 67 (1): 48-53. 3. Müller D, Hoenderop JG, Merkx GF, van Os CH, Bindels RJ (Sep 2000). "Gene structure and chromosomal mapping of human epithelial calcium channel". Biochem. Biophys. Res. Commun. 275 (1): 47-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,186 Da
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 5
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily V member 5
NCBI Official Symbol
TRPV5
NCBI Official Synonym Symbols
CAT2; ECAC1; OTRPC3
NCBI Protein Information
transient receptor potential cation channel subfamily V member 5
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 5
UniProt Gene Name
TRPV5
UniProt Synonym Gene Names
ECAC1; TrpV5; CaT2; ECaC; ECaC1; OTRPC3
UniProt Entry Name
TRPV5_HUMAN

NCBI Description

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq, Jul 2008]

Uniprot Description

TRPV5: Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV5 sub-subfamily.

Protein type: Channel, cation; Membrane protein, multi-pass; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q35

Cellular Component: apical plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: calcium channel activity; calmodulin binding; protein binding

Biological Process: calcium ion transport; protein tetramerization

Research Articles on TRPV5

Similar Products

Product Notes

The TRPV5 trpv5 (Catalog #AAA178072) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TRPV5 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPV5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TRPV5 trpv5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRPV5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.