Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TROVE2 expression in transfected 293T cell line by TROVE2 polyclonal antibody. Lane 1: TROVE2 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TROVE2 Polyclonal Antibody | anti-TROVE2 antibody

TROVE2 (RO60, SSA2, 60kD SS-A/Ro Ribonucleoprotein, Ro 60kD Autoantigen, Sjoegren Syndrome Antigen A2, Sjoegren Syndrome Type A Antigen, TROVE Domain Family Member 2) (AP)

Gene Names
TROVE2; RO60; SSA2; RORNP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TROVE2; Polyclonal Antibody; TROVE2 (RO60; SSA2; 60kD SS-A/Ro Ribonucleoprotein; Ro 60kD Autoantigen; Sjoegren Syndrome Antigen A2; Sjoegren Syndrome Type A Antigen; TROVE Domain Family Member 2) (AP); anti-TROVE2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TROVE2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TROVE2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TROVE2, aa1-538 (NP_004591.2).
Immunogen Sequence
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TROVE2 expression in transfected 293T cell line by TROVE2 polyclonal antibody. Lane 1: TROVE2 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TROVE2 expression in transfected 293T cell line by TROVE2 polyclonal antibody. Lane 1: TROVE2 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TROVE2 antibody
RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation.
Product Categories/Family for anti-TROVE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,270 Da
NCBI Official Full Name
60 kDa SS-A/Ro ribonucleoprotein isoform 2
NCBI Official Synonym Full Names
TROVE domain family, member 2
NCBI Official Symbol
TROVE2
NCBI Official Synonym Symbols
RO60; SSA2; RORNP
NCBI Protein Information
60 kDa SS-A/Ro ribonucleoprotein; 60 kDa ribonucleoprotein Ro; sjoegren syndrome type A antigen; gastric cancer multi-drug resistance protein; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
UniProt Protein Name
60 kDa SS-A/Ro ribonucleoprotein
UniProt Gene Name
TROVE2
UniProt Synonym Gene Names
RO60; SSA2; 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; SS-A
UniProt Entry Name
RO60_HUMAN

Uniprot Description

SSA2: RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation. Belongs to the Ro 60 kDa family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: nucleoplasm; cytoplasm; ribonucleoprotein complex

Molecular Function: RNA binding; metal ion binding; U2 snRNA binding

Biological Process: transcription from RNA polymerase III promoter; immune system development; smoothened signaling pathway; response to UV

Disease: Heart Block, Congenital

Research Articles on TROVE2

Similar Products

Product Notes

The TROVE2 trove2 (Catalog #AAA6397325) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TROVE2 (RO60, SSA2, 60kD SS-A/Ro Ribonucleoprotein, Ro 60kD Autoantigen, Sjoegren Syndrome Antigen A2, Sjoegren Syndrome Type An Antigen, TROVE Domain Family Member 2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TROVE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TROVE2 trove2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TROVE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.