Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TRNT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit TRNT1 Polyclonal Antibody | anti-TRNT1 antibody

TRNT1 Rabbit pAb

Gene Names
TRNT1; CCA1; MtCCA; CGI-47
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
TRNT1; Polyclonal Antibody; TRNT1 Rabbit pAb; CCA1; CGI-47; MtCCA; RPEM; SIFD; anti-TRNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
Applicable Applications for anti-TRNT1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 135-434 of human TRNT1 (NP_886552.2).
Positive Samples
HeLa, A-549, Mouse kidney, Rat spleen, Rat lung, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TRNT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TRNT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-TRNT1 antibody
Background: The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,128 Da
NCBI Official Full Name
CCA tRNA nucleotidyltransferase 1, mitochondrial
NCBI Official Synonym Full Names
tRNA nucleotidyl transferase, CCA-adding, 1
NCBI Official Symbol
TRNT1
NCBI Official Synonym Symbols
CCA1; MtCCA; CGI-47
NCBI Protein Information
CCA tRNA nucleotidyltransferase 1, mitochondrial; mt CCA-adding enzyme; mt tRNA CCA-diphosphorylase; mt tRNA adenylyltransferase; mt tRNA CCA-pyrophosphorylase; tRNA-nucleotidyltransferase 1, mitochondrial; mitochondrial CCA-adding tRNA-nucleotidyltransfe
UniProt Protein Name
CCA tRNA nucleotidyltransferase 1, mitochondrial
UniProt Gene Name
TRNT1
UniProt Synonym Gene Names
CGI-47
UniProt Entry Name
TRNT1_HUMAN

NCBI Description

The CCA-adding enzyme TRNT1 (EC 2.7.7.25) is an essential enzyme that catalyzes the addition of the CCA terminus to the 3-prime end of tRNA precursors. This reaction is a fundamental prerequisite for mature tRNAs to become aminoacylated and to participate in protein biosynthesis (Lizano et al., 2007 [PubMed 17204286]).[supplied by OMIM, Aug 2009]

Uniprot Description

TRNT1: Isoform 1: Adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates. Belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; RNA processing; EC 2.7.7.72; Mitochondrial

Chromosomal Location of Human Ortholog: 3p25.1

Cellular Component: mitochondrion; intracellular

Molecular Function: tRNA adenylyltransferase activity; ATP binding; tRNA binding

Biological Process: tRNA 3'-terminal CCA addition; tRNA 3'-end processing; protein targeting to mitochondrion

Disease: Sideroblastic Anemia With B-cell Immunodeficiency, Periodic Fevers, And Developmental Delay

Research Articles on TRNT1

Similar Products

Product Notes

The TRNT1 trnt1 (Catalog #AAA9142944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRNT1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRNT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TRNT1 trnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HAEVEFTTDW QKDAERRDLT INSMFLGFDG TLFDYFNGYE DLKNKKVRFV GHAKQRIQED YLRILRYFRF YGRIVDKPGD HDPETLEAIA ENAKGLAGIS GERIWVELKK ILVGNHVNHL IHLIYDLDVA PYIGLPANAS LEEFDKVSKN VDGFSPKPVT LLASLFKVQD DVTKLDLRLK IAKEEKNLGL FIVKNRKDLI KATDSSDPLK PYQDFIIDSR EPDATTRVCE LLKYQGEHCL LKEMQQWSIP PFPVSGHDIR KVGISSGKEI GALLQQLREQ WKKSGYQMEK DELLSYIKKT. It is sometimes possible for the material contained within the vial of "TRNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.