Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 polyclonal antibody. Lane 1: TRIP6 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TRIP6 Polyclonal Antibody | anti-TRIP6 antibody

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate

Gene Names
TRIP6; OIP1; OIP-1; ZRP-1; TRIP-6; TRIP6i2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIP6; Polyclonal Antibody; TRIP6 (Thyroid Receptor Interacting Protein 6; Thyroid Hormone Receptor Interactor 6; Thyroid Receptor-interacting Protein 6; TRI6; TRIP 6; TRIP-6; MGC10556; MGC10558; MGC29959; MGC3837; MGC4423; OIP 1; OIP1; OIP-1; OPA-interacting Protein 1; Zyxin-relate; anti-TRIP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TRIP6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
1762
Applicable Applications for anti-TRIP6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TRIP6, aa1-476 (NP_003293.2).
Immunogen Sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 polyclonal antibody. Lane 1: TRIP6 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 polyclonal antibody. Lane 1: TRIP6 transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TRIP6 antibody
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]
Product Categories/Family for anti-TRIP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens thyroid hormone receptor interactor 6 (TRIP6), mRNA
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 6
NCBI Official Symbol
TRIP6
NCBI Official Synonym Symbols
OIP1; OIP-1; ZRP-1; TRIP-6; TRIP6i2
NCBI Protein Information
thyroid receptor-interacting protein 6
UniProt Protein Name
Thyroid receptor-interacting protein 6
UniProt Gene Name
TRIP6
UniProt Synonym Gene Names
OIP1; TR-interacting protein 6; TRIP-6; OIP-1; ZRP-1
UniProt Entry Name
TRIP6_HUMAN

NCBI Description

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIP6: thyroid receptor interacting protein 6 specifically interacts with the ligand-binding domain of the thyroid receptor (TR). Requires the presence of thyroid hormone for its interaction. Interacts with PTPN13. Functions downstream of the activated LPA(2) receptor and is involved in cell adhesion and migration.

Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: interleukin-1 receptor complex; cytoskeleton; focal adhesion; cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; interleukin-1 receptor binding; zinc ion binding; thyroid hormone receptor binding; kinase binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; focal adhesion formation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell migration

Research Articles on TRIP6

Similar Products

Product Notes

The TRIP6 trip6 (Catalog #AAA6397307) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIP6 trip6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.