Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TRIM9 rabbit polyclonal antibody. Western Blot analysis of TRIM9 expression in mouse kidney.)

Rabbit anti-Human, Mouse TRIM9 Polyclonal Antibody | anti-TRIM9 antibody

TRIM9 (E3 Ubiquitin-protein Ligase TRIM9, RING Finger Protein 91, Tripartite Motif-containing Protein 9, KIAA0282, RNF91) (Biotin)

Gene Names
TRIM9; RNF91; SPRING
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM9; Polyclonal Antibody; TRIM9 (E3 Ubiquitin-protein Ligase TRIM9; RING Finger Protein 91; Tripartite Motif-containing Protein 9; KIAA0282; RNF91) (Biotin); anti-TRIM9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TRIM9. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
550
Applicable Applications for anti-TRIM9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TRIM9, aa1-550 (NP_443210.1).
Immunogen Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGKALQQYPSERELRGI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TRIM9 rabbit polyclonal antibody. Western Blot analysis of TRIM9 expression in mouse kidney.)

Western Blot (WB) (TRIM9 rabbit polyclonal antibody. Western Blot analysis of TRIM9 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 polyclonal antibody. Lane 1: TRIM9 transfected lysate (61.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 polyclonal antibody. Lane 1: TRIM9 transfected lysate (61.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TRIM9 antibody
E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions and may also participate in the formation or breakdown of abnormal inclusions in neurodegenerative disorders. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation.
Product Categories/Family for anti-TRIM9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM9 isoform 2
NCBI Official Synonym Full Names
tripartite motif containing 9
NCBI Official Symbol
TRIM9
NCBI Official Synonym Symbols
RNF91; SPRING
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM9
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM9
UniProt Gene Name
TRIM9
UniProt Synonym Gene Names
KIAA0282; RNF91
UniProt Entry Name
TRIM9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on TRIM9

Similar Products

Product Notes

The TRIM9 trim9 (Catalog #AAA6397272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM9 (E3 Ubiquitin-protein Ligase TRIM9, RING Finger Protein 91, Tripartite Motif-containing Protein 9, KIAA0282, RNF91) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM9 trim9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.