Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit TRIM68 Polyclonal Antibody | anti-TRIM68 antibody

TRIM68 antibody - C-terminal region

Gene Names
TRIM68; SS56; GC109; SS-56; RNF137
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
TRIM68; Polyclonal Antibody; TRIM68 antibody - C-terminal region; anti-TRIM68 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGSHI
Sequence Length
485
Applicable Applications for anti-TRIM68 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM68
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-TRIM68 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TRIM68 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TRIM68 antibody
This is a rabbit polyclonal antibody against TRIM68. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by TRIM68 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. TRIM68 is expressed in many cancer cell lines. Its expression in normal tissues, however, was found to be restricted to prostate. TRIM68 was also found to be differentially expressed in androgen-dependent versus androgen-independent prostate cancer cells.
Product Categories/Family for anti-TRIM68 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM68 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 68
NCBI Official Symbol
TRIM68
NCBI Official Synonym Symbols
SS56; GC109; SS-56; RNF137
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM68

NCBI Description

This gene encodes a member of the tripartite motif-containing protein family, whose members are characterized by a "really interesting new gene" (RING) finger domain, a zinc-binding B-box motif, and a coiled-coil region. Members of this family function as E3 ubiquitin ligases and are involved in a broad range of biological processes. This gene regulates the activation of nuclear receptors, such as androgen receptor, and has been implicated in development of prostate cancer cells, where its expression increases in response to a downregulation of microRNAs. In addition, this gene participates in viral defense regulation as a negative regulator of interferon-beta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Research Articles on TRIM68

Similar Products

Product Notes

The TRIM68 (Catalog #AAA3202068) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM68 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM68 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIM68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLRKGNEYRA GTDEYPILSL PVPPRRVGIF VDYEAHDISF YNVTDCGSHI. It is sometimes possible for the material contained within the vial of "TRIM68, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.