Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TRIM5 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit TRIM5 Polyclonal Antibody | anti-TRIM5 antibody

TRIM5 Rabbit pAb

Gene Names
TRIM5; RNF88; TRIM5alpha
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
TRIM5; Polyclonal Antibody; TRIM5 Rabbit pAb; RNF88; TRIM5alpha; anti-TRIM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL
Applicable Applications for anti-TRIM5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 (NP_149083.2).
Cellular Location
Cytoplasm, Nucleus, P-body
Positive Samples
HeLa, SGC-7901, Mouse stomach
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TRIM5 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TRIM5 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-TRIM5 antibody
Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,677 Da
NCBI Official Full Name
tripartite motif protein TRIM5 isoform gamma
NCBI Official Synonym Full Names
tripartite motif containing 5
NCBI Official Symbol
TRIM5
NCBI Official Synonym Symbols
RNF88; TRIM5alpha
NCBI Protein Information
tripartite motif-containing protein 5; ring finger protein 88; tripartite motif protein TRIM5; tripartite motif containing 5 transcript variant iota; tripartite motif containing 5 transcript variant kappa
UniProt Protein Name
Tripartite motif-containing protein 5
UniProt Gene Name
TRIM5
UniProt Synonym Gene Names
RNF88
UniProt Entry Name
TRIM5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

TRIM5: Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity. Belongs to the TRIM/RBCC family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; zinc ion binding; ubiquitin-protein ligase activity; pattern recognition receptor activity; ligase activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; positive regulation of MAPKKK cascade; negative regulation of virion penetration into host cell; cytokine and chemokine mediated signaling pathway; innate immune response; positive regulation of transcription factor activity; pattern recognition receptor signaling pathway; defense response to virus; activation of innate immune response; regulation of lipopolysaccharide-mediated signaling pathway; activation of NF-kappaB transcription factor

Research Articles on TRIM5

Similar Products

Product Notes

The TRIM5 trim5 (Catalog #AAA9142676) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM5 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TRIM5 trim5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKLLLFCQED GKVICWLCER SQEHRGHHTF LTEEVAREYQ VKLQAALEML RQKQQEAEEL EADIREEKAS WKTQIQYDKT NVLADFEQLR DILDWEESNE L. It is sometimes possible for the material contained within the vial of "TRIM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.