Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TRIM5 Polyclonal Antibody | anti-TRIM5 antibody

TRIM5 antibody - N-terminal region

Gene Names
TRIM5; RNF88; TRIM5alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM5; Polyclonal Antibody; TRIM5 antibody - N-terminal region; anti-TRIM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANLVEKLREVK
Sequence Length
493
Applicable Applications for anti-TRIM5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIM5Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TRIM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateTRIM5 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-TRIM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateTRIM5 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-TRIM5 antibody
This is a rabbit polyclonal antibody against TRIM5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-co
Product Categories/Family for anti-TRIM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
tripartite motif-containing protein 5 isoform alpha
NCBI Official Synonym Full Names
tripartite motif containing 5
NCBI Official Symbol
TRIM5
NCBI Official Synonym Symbols
RNF88; TRIM5alpha
NCBI Protein Information
tripartite motif-containing protein 5
UniProt Protein Name
Tripartite motif-containing protein 5
UniProt Gene Name
TRIM5
UniProt Synonym Gene Names
RNF88
UniProt Entry Name
TRIM5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

TRIM5: Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity. Belongs to the TRIM/RBCC family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; zinc ion binding; ubiquitin-protein ligase activity; pattern recognition receptor activity; ligase activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; positive regulation of MAPKKK cascade; negative regulation of virion penetration into host cell; cytokine and chemokine mediated signaling pathway; innate immune response; positive regulation of transcription factor activity; pattern recognition receptor signaling pathway; defense response to virus; activation of innate immune response; regulation of lipopolysaccharide-mediated signaling pathway; activation of NF-kappaB transcription factor

Research Articles on TRIM5

Similar Products

Product Notes

The TRIM5 trim5 (Catalog #AAA3204815) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM5 trim5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CQACLTANHK KSMLDKGESS CPVCRISYQP ENIRPNRHVA NLVEKLREVK. It is sometimes possible for the material contained within the vial of "TRIM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.