Western Blot (WB)
(WB Suggested Anti-TRIM4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Rabbit anti-Human TRIM4 Polyclonal Antibody | anti-TRIM4 antibody
TRIM4 antibody - N-terminal region
Gene Names
TRIM4; RNF87
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM4; Polyclonal Antibody; TRIM4 antibody - N-terminal region; anti-TRIM4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVDEWKRRLIRLLLYHSKQ
Sequence Length
500
Applicable Applications for anti-TRIM4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRIM4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-TRIM4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Related Product Information for anti-TRIM4 antibody
This is a rabbit polyclonal antibody against TRIM4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRIM4 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identi
Target Description: TRIM4 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identi
Product Categories/Family for anti-TRIM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM4 isoform alpha
NCBI Official Synonym Full Names
tripartite motif containing 4
NCBI Official Symbol
TRIM4
NCBI Official Synonym Symbols
RNF87
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM4
UniProt Protein Name
Tripartite motif-containing protein 4
Protein Family
UniProt Gene Name
TRIM4
UniProt Synonym Gene Names
RNF87
UniProt Entry Name
TRIM4_HUMAN
NCBI Description
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternatively spliced transcript variants that encode different isoforms have been described.[provided by RefSeq, Jul 2010]
Research Articles on TRIM4
Similar Products
Product Notes
The TRIM4 trim4 (Catalog #AAA3202347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM4 trim4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVCRESQEHQ THAMAPIDEA FESYRTGNFD IHVDEWKRRL IRLLLYHSKQ. It is sometimes possible for the material contained within the vial of "TRIM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
