Western Blot (WB)
(Host: RabbitTarget Name: TRIB3Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TRIB3 Polyclonal Antibody | anti-TRIB3 antibody
TRIB3 Antibody - N-terminal region
Gene Names
TRIB3; NIPK; SINK; TRB3; SKIP3; C20orf97
Reactivity
Cow, Human, Pig, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIB3; Polyclonal Antibody; TRIB3 Antibody - N-terminal region; anti-TRIB3 antibody
Host
Rabbit
Reactivity
Cow, Human, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV
Sequence Length
385
Applicable Applications for anti-TRIB3 antibody
Western Blot (WB)
Homology
Cow: 91%; Human: 100%; Pig: 91%; Sheep: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TRIB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TRIB3Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TRIB3Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TRIB3 antibody
This is a rabbit polyclonal antibody against TRIB3. It was validated on Western Blot
Target Description: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.
Target Description: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.
Product Categories/Family for anti-TRIB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42kDa
NCBI Official Full Name
tribbles homolog 3 isoform 2
NCBI Official Synonym Full Names
tribbles pseudokinase 3
NCBI Official Symbol
TRIB3
NCBI Official Synonym Symbols
NIPK; SINK; TRB3; SKIP3; C20orf97
NCBI Protein Information
tribbles homolog 3
Protein Family
NCBI Description
The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants. [provided by RefSeq, Jul 2014]
Research Articles on TRIB3
Similar Products
Product Notes
The TRIB3 (Catalog #AAA3213402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIB3 Antibody - N-terminal region reacts with Cow, Human, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TRIB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNNRMSANND HFLTPTWQQM RATPLAAPAG SLSRKKRLEL DDNLDTERPV. It is sometimes possible for the material contained within the vial of "TRIB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
