Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TREX1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TREX1 Polyclonal Antibody | anti-TREX1 antibody

TREX1 Antibody - middle region

Gene Names
TREX1; CRV; AGS1; DRN3; HERNS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TREX1; Polyclonal Antibody; TREX1 Antibody - middle region; anti-TREX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTS
Sequence Length
369
Applicable Applications for anti-TREX1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TREX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TREX1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TREX1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TREX1 antibody
This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TREX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Synonym Full Names
three prime repair exonuclease 1
NCBI Official Symbol
TREX1
NCBI Official Synonym Symbols
CRV; AGS1; DRN3; HERNS
NCBI Protein Information
three-prime repair exonuclease 1
UniProt Protein Name
Three-prime repair exonuclease 1
UniProt Gene Name
TREX1
UniProt Entry Name
TREX1_HUMAN

NCBI Description

This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]

Uniprot Description

TREX1: the major 3' DNA exonuclease in mammalian cells. Normally associates with the endoplasmic reticulum (ER). Translocates to the nucleus at S phase after DNA damage by gamma-irradiation or hydroxyurea. Trex1-deficient cells show defective G1/S transition, with single-stranded DNA molecules persisting after S phase and accumulating in the ER. Degrades ssDNA. Prevents chronic checkpoint activation and inappropriate immune activation. Mutations cause Aicardi-Goutieres syndrome, an autoimmune disorder. Trex1a(-/-) mice have autoinflammatory responses. The gene for this protein is either identical to or adjacent to that of ATRIP. Some of the mRNAs that encode TREX1 also encode ATRIP in another reading frame. Three alternatively spliced human isoforms have been reported.

Protein type: EC 3.1.11.2; Cell cycle regulation; DNA-binding; DNA repair, damage; Deoxyribonuclease

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: endoplasmic reticulum membrane; nucleolus; nuclear envelope; nucleus; cytosol

Molecular Function: protein homodimerization activity; metal ion binding; double-stranded DNA binding; exodeoxyribonuclease III activity; 3'-5'-exodeoxyribonuclease activity; MutLalpha complex binding; adenyl deoxyribonucleotide binding; 3'-5' exonuclease activity; MutSalpha complex binding; single-stranded DNA binding

Biological Process: regulation of interferon type I production; mismatch repair; positive regulation of interferon type I production; innate immune response; DNA replication; DNA repair; DNA catabolic process, exonucleolytic; DNA metabolic process; DNA recombination

Disease: Chilblain Lupus 1; Vasculopathy, Retinal, With Cerebral Leukodystrophy; Aicardi-goutieres Syndrome 1; Systemic Lupus Erythematosus

Research Articles on TREX1

Similar Products

Product Notes

The TREX1 trex1 (Catalog #AAA3220010) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TREX1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TREX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TREX1 trex1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRQCFDDNLA NLLLAFLRRQ PQPWCLVAHN GDRYDFPLLQ AELAMLGLTS. It is sometimes possible for the material contained within the vial of "TREX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.