Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of TREM2 in various cell lines using TREM2 Rabbit antibody at dilution 1:500.)

Rabbit TREM2 Polyclonal Antibody | anti-TREM2 antibody

TREM2 Rabbit pAb

Gene Names
TREM2; TREM-2; Trem2a; Trem2b; Trem2c
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Purity
Affinity purified
Synonyms
TREM2; Polyclonal Antibody; TREM2 Rabbit pAb; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2; anti-TREM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.
Purity/Purification
Affinity purified
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Applicable Applications for anti-TREM2 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:1000
IHC: 1:50-1:200
IF: 1:20-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS
Positive Control
Mouse brain
Conjugation
Unconjugated
Modification
Unmodified
Cell Position
Cell membrane, Secreted, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of TREM2 in various cell lines using TREM2 Rabbit antibody at dilution 1:500.)

Western Blot (WB) (Western blot analysis of TREM2 in various cell lines using TREM2 Rabbit antibody at dilution 1:500.)

Immunohistochemistry (IHC)

(Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human tonsil using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC) (Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human tonsil using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC)

(Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human colon carcinoma using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC) (Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human colon carcinoma using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC)

(Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human gastric cancer using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC) (Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded human gastric cancer using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC)

(Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded mouse spleen using TREM2 antibody at dilution of 1:200 .)

Immunohistochemistry (IHC) (Immunohistochemistry - TREM2 Polyclonal Antibody. Immunohistochemistry of paraffin-embedded mouse spleen using TREM2 antibody at dilution of 1:200 .)

Immunofluorescence (IF)

(Immunofluorescence - TREM2 Polyclonal Antibody. Immunofluorescence analysis of U-251MG cells using TREM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - TREM2 Polyclonal Antibody. Immunofluorescence analysis of U-251MG cells using TREM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence - TREM2 Polyclonal Antibody. Immunofluorescence analysis of mouse lung cells using TREM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - TREM2 Polyclonal Antibody. Immunofluorescence analysis of mouse lung cells using TREM2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-TREM2 antibody
This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-TREM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,669 Da
NCBI Official Full Name
triggering receptor expressed on myeloid cells 2 isoform 1
NCBI Official Synonym Full Names
triggering receptor expressed on myeloid cells 2
NCBI Official Symbol
TREM2
NCBI Official Synonym Symbols
TREM-2; Trem2a; Trem2b; Trem2c
NCBI Protein Information
triggering receptor expressed on myeloid cells 2
UniProt Protein Name
Triggering receptor expressed on myeloid cells 2
UniProt Gene Name
TREM2
UniProt Synonym Gene Names
TREM-2

NCBI Description

This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]

Uniprot Description

Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Research Articles on TREM2

Similar Products

Product Notes

The TREM2 trem2 (Catalog #AAA4757673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TREM2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TREM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF). WB: 1:500-1:1000 IHC: 1:50-1:200 IF: 1:20-1:100. Researchers should empirically determine the suitability of the TREM2 trem2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TREM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.