Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TRAPPC6ASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TRAPPC6A Polyclonal Antibody | anti-TRAPPC6A antibody

TRAPPC6A Antibody - N-terminal region

Gene Names
TRAPPC6A; TRS33
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRAPPC6A; Polyclonal Antibody; TRAPPC6A Antibody - N-terminal region; anti-TRAPPC6A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET
Sequence Length
173
Applicable Applications for anti-TRAPPC6A antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAPPC6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TRAPPC6ASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRAPPC6ASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TRAPPC6A antibody
This is a rabbit polyclonal antibody against TRAPPC6A. It was validated on Western Blot

Target Description: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-TRAPPC6A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
trafficking protein particle complex subunit 6A isoform 1
NCBI Official Synonym Full Names
trafficking protein particle complex 6A
NCBI Official Symbol
TRAPPC6A
NCBI Official Synonym Symbols
TRS33
NCBI Protein Information
trafficking protein particle complex subunit 6A
UniProt Protein Name
Trafficking protein particle complex subunit 6A
UniProt Gene Name
TRAPPC6A
UniProt Synonym Gene Names
TRAPP complex subunit 6A
UniProt Entry Name
TPC6A_HUMAN

NCBI Description

This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

TRAPPC6A: May play a role in vesicular transport during the biogenesis of melanosomes. Belongs to the TRAPP small subunits family. BET3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: Golgi apparatus; endoplasmic reticulum

Molecular Function: protein binding

Biological Process: vesicle-mediated transport

Research Articles on TRAPPC6A

Similar Products

Product Notes

The TRAPPC6A trappc6a (Catalog #AAA3217977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAPPC6A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRAPPC6A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRAPPC6A trappc6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HDPDPGPGVS AGLRGEEAGA TKGQKMSLSV LEGMGFRVGQ ALGERLPRET. It is sometimes possible for the material contained within the vial of "TRAPPC6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.