Transforming Growth Factor-beta 2 Polyclonal Antibody | anti-TGFB2 antibody
Polyclonal Rabbit Anti Human Transforming Growth Factor-beta 2
Purity
Greater than 98%.Purified IgG prepared by affinity chromatography on protein G.
Synonyms
Transforming Growth Factor-beta 2; Polyclonal Antibody; Polyclonal Rabbit Anti Human Transforming Growth Factor-beta 2; TGFB2 Antibody; Transforming Growth Factor-beta 2 Polyclonal Rabbit Anti Human Antibody; Transforming growth factor; beta 2; cetermin; Glioblastoma-derived T-cell suppressor factor; polyergin; G-TSF; TGF-beta2; TGF-beta-2; transforming growth factor beta-2; BSC-1 cell growth inhibitor; TGFB-2; anti-TGFB2 antibody
Clonality
Polyclonal
Purity/Purification
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Purified IgG prepared by affinity chromatography on protein G.
Form/Format
Lyophilized from a sterile filtered (0.2 um) solution containing phosphate buffered saline.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Sequence Length
411
Solubility
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Immunogen
IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.
Preparation and Storage
Store at -20 degree C. For long term storage freezes in working aliquots at -20 degree C. Repeated freezing and thawing is not recommended.
Related Product Information for anti-TGFB2 antibody
Introduction: TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
Product Categories/Family for anti-TGFB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
transforming growth factor beta-2
NCBI Official Synonym Full Names
transforming growth factor, beta 2
NCBI Official Symbol
tgfb2
NCBI Protein Information
transforming growth factor beta-2; tgf beta 2
Protein Family
Research Articles on TGFB2
Similar Products
Product Notes
The TGFB2 (Catalog #AAA141024) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ALDAAYCFRN VQDNCCLRPL YIDFKRDLGW KWIHEPKGYN ANFCAGACPY LWSSDTQHSR VLSLYNTINP EASASPCCVS QDLEPLTILY YIGKTPKIEQ LSNMIVKSCK CS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor-beta 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
