Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Tram2Sample Type: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Tram2 Polyclonal Antibody | anti-TRAM2 antibody

Tram2 Antibody - C-terminal region

Gene Names
Tram2; C330003D03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tram2; Polyclonal Antibody; Tram2 Antibody - C-terminal region; anti-TRAM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YWKEQSAKRRVSAVPRPPAKLLKREPGYHENGVVKAENGTSSRTKKLKSP
Sequence Length
370
Applicable Applications for anti-TRAM2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Tram2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Tram2Sample Type: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Tram2Sample Type: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TRAM2 antibody
This is a rabbit polyclonal antibody against Tram2. It was validated on Western Blot

Target Description: Tram2 is necessary for collagen type I synthesis. It may couple the activity of the ER Ca2+ pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca2+ concentration at the site of collagen synthesis, and a high Ca2+ concentration may be necessary for the function of molecular chaperones involved in collagen folding.
Product Categories/Family for anti-TRAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
translocating chain-associated membrane protein 2
NCBI Official Synonym Full Names
translocating chain-associating membrane protein 2
NCBI Official Symbol
Tram2
NCBI Official Synonym Symbols
C330003D03Rik
NCBI Protein Information
translocating chain-associated membrane protein 2
UniProt Protein Name
Translocating chain-associated membrane protein 2
UniProt Gene Name
Tram2
UniProt Entry Name
TRAM2_MOUSE

Uniprot Description

TRAM2: Necessary for collagen type I synthesis. May couple the activity of the ER Ca(2+) pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca(2+) concentration at the site of collagen synthesis, and a high Ca(2+) concentration may be necessary for the function of molecular chaperones involved in collagen folding. Belongs to the TRAM family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: membrane; integral to membrane

Molecular Function: protein binding

Biological Process: protein transport; transport; collagen biosynthetic process

Research Articles on TRAM2

Similar Products

Product Notes

The TRAM2 tram2 (Catalog #AAA3208370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tram2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tram2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRAM2 tram2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YWKEQSAKRR VSAVPRPPAK LLKREPGYHE NGVVKAENGT SSRTKKLKSP. It is sometimes possible for the material contained within the vial of "Tram2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.