Western Blot (WB)
(TOM1 antibody (MBS5303292) used at 1 ug/ml to detect target protein.)
Rabbit TOM1 Polyclonal Antibody | anti-TOM1 antibody
TOM1 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
TOM1; Polyclonal Antibody; TOM1 antibody; Polyclonal TOM1; Anti-TOM1; TOM 1; TOM-1; Target Of Myb1; FLJ33404; anti-TOM1 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOM1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
492
Applicable Applications for anti-TOM1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Cross-Reactivity
Human
Immunogen
TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TOM1 antibody (MBS5303292) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TOM1 antibody (MBS5303292) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TOM1 antibody
Rabbit polyclonal TOM1 antibody
Product Categories/Family for anti-TOM1 antibody
NCBI and Uniprot Product Information
Uniprot Description
TOM1: May be involved in intracellular trafficking. Probable association with membranes. Belongs to the TOM1 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 22q13.1
Cellular Component: membrane; early endosome; cytoplasm; cytosol; endosome
Molecular Function: clathrin binding; protein binding
Biological Process: intracellular protein transport; protein transport; endocytosis; endosome transport
Similar Products
Product Notes
The TOM1 tom1 (Catalog #AAA5303292) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TOM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TOM1 tom1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
