Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TOB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit TOB1 Polyclonal Antibody | anti-TOB1 antibody

TOB1 antibody - middle region

Gene Names
TOB1; TOB; TROB; APRO5; APRO6; PIG49; TROB1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TOB1; Polyclonal Antibody; TOB1 antibody - middle region; anti-TOB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT
Sequence Length
345
Applicable Applications for anti-TOB1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 82%; Pig: 93%; Rat: 92%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TOB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TOB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TOB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TOB1 antibody
This is a rabbit polyclonal antibody against TOB1. It was validated on Western Blot

Target Description: This gene encodes a member of the tob/btg1 family of anti-proliferative proteins that have the potential to regulate cell growth. When exogenously expressed, this protein supresses cell growth in tissue culture. The protein undergoes phophorylation by a serine/threonine kinase, 90 kDa ribosomal S6 kinase. Interactions of this protein with the v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 gene product p185 interferes with growth suppression. This protein inhibits T cell proliferation and transcription of cytokines and cyclins. The protein interacts with both mothers against decapentaplegic Drosophila homolog 2 and 4 to enhance their DNA binding activity. This interaction inhibits interleukin 2 transcription in T cells.
Product Categories/Family for anti-TOB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
protein Tob1 isoform 1
NCBI Official Synonym Full Names
transducer of ERBB2, 1
NCBI Official Symbol
TOB1
NCBI Official Synonym Symbols
TOB; TROB; APRO5; APRO6; PIG49; TROB1
NCBI Protein Information
protein Tob1
UniProt Protein Name
Protein Tob1
Protein Family
UniProt Gene Name
TOB1
UniProt Synonym Gene Names
TOB; TROB1
UniProt Entry Name
TOB1_HUMAN

NCBI Description

This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

TOB1: Anti-proliferative protein that interacts with the erbB- 2 receptor tyrosine kinase. May physically and/or functionally interact with protein-tyrosine kinase receptors. Belongs to the BTG family.

Protein type: Adaptor/scaffold; Cell cycle regulation

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; nucleus; CCR4-NOT complex

Molecular Function: protein binding; SH3/SH2 adaptor activity; SMAD binding; receptor tyrosine kinase binding; transcription corepressor activity

Biological Process: negative regulation of cell proliferation; positive regulation of signal transduction; negative regulation of translation; negative regulation of osteoblast differentiation; SMAD protein nuclear translocation; negative regulation of BMP signaling pathway

Research Articles on TOB1

Similar Products

Product Notes

The TOB1 tob1 (Catalog #AAA3210610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOB1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TOB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOB1 tob1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLLKQKAISS SMHSLYGLGL GSQQQPQQQQ QPAQPPPPPP PPQQQQQQKT. It is sometimes possible for the material contained within the vial of "TOB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.