Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNNI3K Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit TNNI3K Polyclonal Antibody | anti-TNNI3K antibody

TNNI3K antibody - N-terminal region

Gene Names
FPGT-TNNI3K; CARK; TNNI3K
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNNI3K; Polyclonal Antibody; TNNI3K antibody - N-terminal region; anti-TNNI3K antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED
Sequence Length
936
Applicable Applications for anti-TNNI3K antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TNNI3K
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNNI3K Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TNNI3K Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TNNI3K antibody
This is a rabbit polyclonal antibody against TNNI3K. It was validated on Western Blot

Target Description: TNNI3K may play a role in cardiac physiology.
Product Categories/Family for anti-TNNI3K antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
FPGT-TNNI3K fusion protein isoform a
NCBI Official Synonym Full Names
FPGT-TNNI3K readthrough
NCBI Official Symbol
FPGT-TNNI3K
NCBI Official Synonym Symbols
CARK; TNNI3K
NCBI Protein Information
FPGT-TNNI3K fusion protein
UniProt Protein Name
Serine/threonine-protein kinase TNNI3K
UniProt Gene Name
TNNI3K
UniProt Synonym Gene Names
CARK
UniProt Entry Name
TNI3K_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription from the neighboring fucose-1-phosphate guanylyltransferase (FPGT) and TNNI3 interacting kinase (TNNI3K) genes. Alternative splicing results in multiple transcript variants that are composed of in-frame exons from each individual gene. [provided by RefSeq, Dec 2010]

Uniprot Description

TNNI3K: May play a role in cardiac physiology. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; TKL group; MLK family; HH498 subfamily

Chromosomal Location of Human Ortholog: 1p31.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein C-terminus binding; protein serine/threonine kinase activity; protein binding; troponin I binding; metal ion binding; ATP binding; protein kinase activity

Biological Process: regulation of heart rate; protein amino acid phosphorylation

Disease: Cardiac Conduction Disease With Or Without Dilated Cardiomyopathy

Similar Products

Product Notes

The TNNI3K tnni3k (Catalog #AAA3208833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNNI3K antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TNNI3K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNNI3K tnni3k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLKFGADVNV SGEVGDRPLH LASAKGFLNI AKLLMEEGSK ADVNAQDNED. It is sometimes possible for the material contained within the vial of "TNNI3K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.