Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TNK1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit TNK1 Polyclonal Antibody | anti-TNK1 antibody

TNK1 antibody - C-terminal region

Reactivity
Guinea Pig, Human, Pig, Rabbit, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNK1; Polyclonal Antibody; TNK1 antibody - C-terminal region; anti-TNK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Pig, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWPKRKPPHNHPMG
Sequence Length
661
Applicable Applications for anti-TNK1 antibody
Western Blot (WB)
Homology
Guinea Pig: 83%; Human: 100%; Pig: 85%; Rabbit: 77%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TNK1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-TNK1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: TNK1Antibody Dilution: 1.0ug/mlSample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Western Blot (WB) (Host: RabbitTarget Name: TNK1Antibody Dilution: 1.0ug/mlSample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-TNK1 antibody
This is a rabbit polyclonal antibody against TNK1. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is highly expressed in fetal tissues and at lower levels in few adult tissues, thus may function in signaling pathways utilized broadly during fetal development, and more selectively in adult tissues. It plays a negative regulatory role in the Ras-Raf1-MAPK pathway, and knockout mice have been shown to develop spontaneous tumors, suggesting a role as a tumor suppressor gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
non-receptor tyrosine-protein kinase TNK1 isoform 2
NCBI Official Synonym Full Names
tyrosine kinase non receptor 1
NCBI Official Symbol
TNK1
NCBI Protein Information
non-receptor tyrosine-protein kinase TNK1
UniProt Protein Name
Non-receptor tyrosine-protein kinase TNK1
UniProt Gene Name
TNK1
UniProt Entry Name
TNK1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is highly expressed in fetal tissues and at lower levels in few adult tissues, thus may function in signaling pathways utilized broadly during fetal development, and more selectively in adult tissues. It plays a negative regulatory role in the Ras-Raf1-MAPK pathway, and knockout mice have been shown to develop spontaneous tumors, suggesting a role as a tumor suppressor gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

TNK1: Involved in negative regulation of cell growth. Has tumor suppressor properties. Plays a negative regulatory role in the Ras-MAPK pathway. May function in signaling pathways utilized broadly during fetal development and more selectively in adult tissues and in cells of the lymphohematopoietic system. Could specifically be involved in phospholipid signal transduction. Interacts with the SH3 domain of PLCG1 via its Pro-rich domain. Expressed in all umbilical cord blood, bone marrow and adult blood cell sub-populations and in several leukemia cell lines. Highly expressed in fetal blood, brain, lung, liver and kidney. Detected at lower levels in adult prostate, testis, ovary, small intestine and colon. Not expressed in adult lung, liver, kidney or brain. Belongs to the protein kinase superfamily. Tyr protein kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.2; Protein kinase, tyrosine (non-receptor); TK group; Ack family

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: extrinsic to internal side of plasma membrane; membrane; cytoplasm; cytosol

Molecular Function: protein binding; signal transducer activity; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; ATP binding; hormone receptor binding

Biological Process: cell migration; protein amino acid autophosphorylation; negative regulation of Ras protein signal transduction; innate immune response; negative regulation of cell growth; cell differentiation; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation

Research Articles on TNK1

Similar Products

Product Notes

The TNK1 tnk1 (Catalog #AAA3216669) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNK1 antibody - C-terminal region reacts with Guinea Pig, Human, Pig, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TNK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNK1 tnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIRQARAVPQ GPPGLPPRPP LSSSSPQPSQ PSRERLPWPK RKPPHNHPMG. It is sometimes possible for the material contained within the vial of "TNK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.