Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TNFSF18 rabbit polyclonal antibody. Western Blot analysis of TNFSF18 expression in HeLa.)

Rabbit anti-Human TNFSF18 Polyclonal Antibody | anti-TNFSF18 antibody

TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, Activation-inducible TNF-related Ligand, AITRL, Glucocorticoid-induced TNF-related Ligand, GITRL, hGITRL, TL6, UNQ149/PRO175) (PE)

Gene Names
TNFSF18; TL6; AITRL; GITRL; TNLG2A; hGITRL
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFSF18; Polyclonal Antibody; TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18; Activation-inducible TNF-related Ligand; AITRL; Glucocorticoid-induced TNF-related Ligand; GITRL; hGITRL; TL6; UNQ149/PRO175) (PE); anti-TNFSF18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TNFSF18.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
748
Applicable Applications for anti-TNFSF18 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TNFSF18, aa1-177 (NP_005083.1).
Immunogen Sequence
MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TNFSF18 rabbit polyclonal antibody. Western Blot analysis of TNFSF18 expression in HeLa.)

Western Blot (WB) (TNFSF18 rabbit polyclonal antibody. Western Blot analysis of TNFSF18 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TNFSF18 expression in transfected 293T cell line by TNFSF18 polyclonal antibody. Lane 1: TNFSF18 transfected lysate (20.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TNFSF18 expression in transfected 293T cell line by TNFSF18 polyclonal antibody. Lane 1: TNFSF18 transfected lysate (20.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TNFSF18 antibody
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. [provided by RefSeq]
Product Categories/Family for anti-TNFSF18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens TNF superfamily member 18 (TNFSF18), mRNA
NCBI Official Synonym Full Names
TNF superfamily member 18
NCBI Official Symbol
TNFSF18
NCBI Official Synonym Symbols
TL6; AITRL; GITRL; TNLG2A; hGITRL
NCBI Protein Information
tumor necrosis factor ligand superfamily member 18
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 18
UniProt Gene Name
TNFSF18
UniProt Synonym Gene Names
AITRL; GITRL; TL6; AITRL; hGITRL
UniProt Entry Name
TNF18_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF18: Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T- cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Belongs to the tumor necrosis factor family.

Protein type: Membrane protein, integral; Apoptosis; Cytokine

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; cell surface; plasma membrane; integral to membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding; receptor binding

Biological Process: tumor necrosis factor-mediated signaling pathway; cell-cell signaling; T cell proliferation during immune response; regulation of T cell proliferation; signal transduction; negative regulation of apoptosis; activation of NF-kappaB transcription factor

Research Articles on TNFSF18

Similar Products

Product Notes

The TNFSF18 tnfsf18 (Catalog #AAA6396774) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, Activation-inducible TNF-related Ligand, AITRL, Glucocorticoid-induced TNF-related Ligand, GITRL, hGITRL, TL6, UNQ149/PRO175) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFSF18 tnfsf18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFSF18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.