Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human muscle)

Rabbit TNFSF12 Polyclonal Antibody | anti-TNFSF12 antibody

TNFSF12 antibody - N-terminal region

Gene Names
TNFSF12; APO3L; DR3LG; TWEAK; TNLG4A
Reactivity
Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFSF12; Polyclonal Antibody; TNFSF12 antibody - N-terminal region; anti-TNFSF12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
Sequence Length
249
Applicable Applications for anti-TNFSF12 antibody
Western Blot (WB)
Homology
Horse: 93%; Human: 100%; Mouse: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human muscle)

Western Blot (WB) (WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human muscle)
Related Product Information for anti-TNFSF12 antibody
This is a rabbit polyclonal antibody against TNFSF12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 12 proprotein
NCBI Official Synonym Full Names
TNF superfamily member 12
NCBI Official Symbol
TNFSF12
NCBI Official Synonym Symbols
APO3L; DR3LG; TWEAK; TNLG4A
NCBI Protein Information
tumor necrosis factor ligand superfamily member 12
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 12
UniProt Gene Name
TNFSF12
UniProt Synonym Gene Names
APO3L; DR3LG; TWEAK
UniProt Entry Name
TNF12_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants. Some transcripts skip the last exon of this gene and continue into the second exon of the neighboring TNFSF13 gene; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]

Uniprot Description

TNFSF12: Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Homotrimer (Potential). Interacts with the angiogenic factor AGGF1/VG5Q. Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Also detected in fetal kidney, liver, lung and brain. Belongs to the tumor necrosis factor family.

Protein type: Motility/polarity/chemotaxis; Apoptosis; Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: extracellular space; integral to plasma membrane; perinuclear region of cytoplasm

Molecular Function: protein binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: positive regulation of angiogenesis; apoptosis; positive regulation of protein catabolic process; endothelial cell migration; immune response; positive regulation of endothelial cell proliferation; angiogenesis; cell differentiation; signal transduction

Research Articles on TNFSF12

Similar Products

Product Notes

The TNFSF12 tnfsf12 (Catalog #AAA3224530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF12 antibody - N-terminal region reacts with Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFSF12 tnfsf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEELVAEEDQ DPSELNPQTE ESQDPAPFLN RLVRPRRSAP KGRKTRARRA. It is sometimes possible for the material contained within the vial of "TNFSF12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.