Western Blot (WB)
(Western blot analysis of extracts of HT-1080 cells, using TNFRSF12A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human TNFRSF12A Polyclonal Antibody | anti-TNFRSF12A antibody
TNFRSF12A Polyclonal Antibody
Gene Names
TNFRSF12A; FN14; CD266; TWEAKR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TNFRSF12A; Polyclonal Antibody; TNFRSF12A Polyclonal Antibody; CD266; FN14; TWEAKR; anti-TNFRSF12A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Sequence Length
129
Applicable Applications for anti-TNFRSF12A antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TNFRSF12A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein
Positive Samples
HT-1080
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of HT-1080 cells, using TNFRSF12A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of HT-1080 cells, using TNFRSF12A antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-TNFRSF12A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 10kDa; 13kDa
Observed: 14kDa
Observed: 14kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 12A
NCBI Official Synonym Full Names
TNF receptor superfamily member 12A
NCBI Official Symbol
TNFRSF12A
NCBI Official Synonym Symbols
FN14; CD266; TWEAKR
NCBI Protein Information
tumor necrosis factor receptor superfamily member 12A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 12A
Protein Family
UniProt Gene Name
TNFRSF12A
UniProt Synonym Gene Names
FN14; FGF-inducible 14; TweakR
Uniprot Description
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
Research Articles on TNFRSF12A
Similar Products
Product Notes
The TNFRSF12A tnfrsf12a (Catalog #AAA9133142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF12A Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TNFRSF12A tnfrsf12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EQAPGTAPCS RGSSWSADLD KCMDCASCRA RPHSDFCLGC AAAPPAPFRL LWPILGGALS LTFVLGLLSG FLVWRRCRRR EKFTTPIEET GGEGCPAVAL IQ. It is sometimes possible for the material contained within the vial of "TNFRSF12A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
