Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TNFRSF10D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 20s.)
Rabbit anti-Human, Rat TNFRSF10D Polyclonal Antibody | anti-TNFRSF10D antibody
TNFRSF10D Polyclonal Antibody
Gene Names
TNFRSF10D; DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TNFRSF10D; Polyclonal Antibody; TNFRSF10D Polyclonal Antibody; CD264; DCR2; TRAIL-R4; TRAILR4; TRUNDD; anti-TNFRSF10D antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Sequence Length
386
Applicable Applications for anti-TNFRSF10D antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TNFRSF10D
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein
Positive Samples
22Rv1, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TNFRSF10D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 20s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TNFRSF10D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 20s.)
Related Product Information for anti-TNFRSF10D antibody
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.
Product Categories/Family for anti-TNFRSF10D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 41kDa
Observed: 42kDa
Observed: 42kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 10D
NCBI Official Synonym Full Names
TNF receptor superfamily member 10d
NCBI Official Symbol
TNFRSF10D
NCBI Official Synonym Symbols
DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10D
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10D
Protein Family
UniProt Gene Name
TNFRSF10D
UniProt Synonym Gene Names
DCR2; TRAILR4; TRUNDD; DcR2; TRAIL receptor 4; TRAIL-R4
NCBI Description
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis. [provided by RefSeq, Jul 2008]
Uniprot Description
Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway.
Research Articles on TNFRSF10D
Similar Products
Product Notes
The TNFRSF10D tnfrsf10d (Catalog #AAA9134087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF10D Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF10D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TNFRSF10D tnfrsf10d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLFRRRSCPS RVPGAEDNAR NETLSNRYLQ PTQVSEQEIQ GQELAELTGV TVELPEEPQR LLEQAEAEGC QRRRLLVPVN DADSADISTL LDASATLEEG HAKETIQDQL VGSEKLFYEE DEAGSATSCL. It is sometimes possible for the material contained within the vial of "TNFRSF10D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
