Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using TMPRSS5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human TMPRSS5 Polyclonal Antibody | anti-TMPRSS5 antibody
TMPRSS5 Polyclonal Antibody
Gene Names
TMPRSS5; SPINESIN
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TMPRSS5; Polyclonal Antibody; TMPRSS5 Polyclonal Antibody; SPINESIN; anti-TMPRSS5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKE
Sequence Length
344
Applicable Applications for anti-TMPRSS5 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TMPRSS5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Single-pass type II membrane protein
Positive Samples
U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using TMPRSS5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of U-87MG cells, using TMPRSS5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-TMPRSS5 antibody
This gene encodes a protein that belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TMPRSS5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 49kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
transmembrane protease serine 5 isoform 2
NCBI Official Synonym Full Names
transmembrane serine protease 5
NCBI Official Symbol
TMPRSS5
NCBI Official Synonym Symbols
SPINESIN
NCBI Protein Information
transmembrane protease serine 5
UniProt Protein Name
Transmembrane protease serine 5
Protein Family
UniProt Gene Name
TMPRSS5
NCBI Description
This gene encodes a protein that belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Uniprot Description
May play a role in hearing.
Research Articles on TMPRSS5
Similar Products
Product Notes
The TMPRSS5 tmprss5 (Catalog #AAA9134312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS5 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TMPRSS5 tmprss5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PISGTLQDEE ITLSCSEASA EEALLPALPK TVSFRINSED FLLEAQVRDQ PRWLLVCHEG WSPALGLQIC WSLGHLRLTH HKGVNLTDIK LNSSQEFAQL SPRLGGFLEE AWQPRNNCTS GQVVSLRCSE CGARPLASRI VGGQSVAPGR WPWQASVALG FRHTCGGSVL APRWVVTAAH CMHSFRLARL SSWRVHAGLV SHSAVRPHQG ALVERIIPHP LYSAQNHDYD VALLRLQTAL NFSDTVGAVC LPAKE. It is sometimes possible for the material contained within the vial of "TMPRSS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
