Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMOD2 rabbit polyclonal antibody. Western Blot analysis of TMOD2 expression in human pancreas.)

Rabbit anti-Human TMOD2 Polyclonal Antibody | anti-TMOD2 antibody

TMOD2 (NTMOD, Tropomodulin-2, Neuronal Tropomodulin) APC

Gene Names
TMOD2; NTMOD; N-TMOD
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TMOD2; Polyclonal Antibody; TMOD2 (NTMOD; Tropomodulin-2; Neuronal Tropomodulin) APC; anti-TMOD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMOD2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
9150
Applicable Applications for anti-TMOD2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TMOD2, aa1-351 (NP_055363.1).
Immunogen Sequence
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TMOD2 rabbit polyclonal antibody. Western Blot analysis of TMOD2 expression in human pancreas.)

Western Blot (WB) (TMOD2 rabbit polyclonal antibody. Western Blot analysis of TMOD2 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of TMOD2 expression in transfected 293T cell line by TMOD2 polyclonal antibody. Lane 1: TMOD2 transfected lysate (39.6kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of TMOD2 expression in transfected 293T cell line by TMOD2 polyclonal antibody. Lane 1: TMOD2 transfected lysate (39.6kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-TMOD2 antibody
This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-TMOD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tropomodulin 2 (TMOD2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
tropomodulin 2
NCBI Official Symbol
TMOD2
NCBI Official Synonym Symbols
NTMOD; N-TMOD
NCBI Protein Information
tropomodulin-2
UniProt Protein Name
Tropomodulin-2
Protein Family
UniProt Gene Name
TMOD2
UniProt Synonym Gene Names
NTMOD; N-Tmod

NCBI Description

This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Dec 2008]

Uniprot Description

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton ().

Research Articles on TMOD2

Similar Products

Product Notes

The TMOD2 tmod2 (Catalog #AAA6396688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMOD2 (NTMOD, Tropomodulin-2, Neuronal Tropomodulin) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMOD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMOD2 tmod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMOD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.