Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TMLHE Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Rabbit TMLHE Polyclonal Antibody | anti-TMLHE antibody

TMLHE antibody - middle region

Gene Names
TMLHE; TMLD; TMLH; BBOX2; AUTSX6; TMLHED; XAP130
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMLHE; Polyclonal Antibody; TMLHE antibody - middle region; anti-TMLHE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV
Sequence Length
421
Applicable Applications for anti-TMLHE antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMLHE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TMLHE Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-TMLHE Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-TMLHE antibody
This is a rabbit polyclonal antibody against TMLHE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded prot
Product Categories/Family for anti-TMLHE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
trimethyllysine dioxygenase, mitochondrial isoform 1
NCBI Official Synonym Full Names
trimethyllysine hydroxylase, epsilon
NCBI Official Symbol
TMLHE
NCBI Official Synonym Symbols
TMLD; TMLH; BBOX2; AUTSX6; TMLHED; XAP130
NCBI Protein Information
trimethyllysine dioxygenase, mitochondrial
UniProt Protein Name
Trimethyllysine dioxygenase, mitochondrial
UniProt Gene Name
TMLHE
UniProt Synonym Gene Names
TMLH; TML dioxygenase; TMLD
UniProt Entry Name
TMLH_HUMAN

NCBI Description

This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded protein converts trimethyllysine into hydroxytrimethyllysine. A pseudogene of this gene is found on chromosome X. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

TMLHE: Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML). Defects in TMLHE are the cause of epsilon-trimethyllysine hydroxylase deficiency (TMLHED). An inborn error of carnitine biosynthesis associated with an increased risk for developing autistic behavior. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. Belongs to the gamma-BBH/TMLD family. 8 isoforms of the human protein are produced by alternative promoter.

Protein type: Mitochondrial; Oxidoreductase; Amino Acid Metabolism - lysine degradation; EC 1.14.11.8

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; trimethyllysine dioxygenase activity; L-ascorbic acid binding; iron ion binding

Biological Process: negative regulation of oxidoreductase activity; carnitine biosynthetic process

Disease: Epsilon-trimethyllysine Hydroxylase Deficiency

Research Articles on TMLHE

Similar Products

Product Notes

The TMLHE tmlhe (Catalog #AAA3213196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMLHE antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMLHE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMLHE tmlhe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PWNKELYLIR YNNYDRAVIN TVPYDVVHRW YTAHRTLTIE LRRPENEFWV. It is sometimes possible for the material contained within the vial of "TMLHE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.